SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77164418|ref|YP_342943.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77164418|ref|YP_342943.1|
Domain Number 1 Region: 29-192
Classification Level Classification E-value
Superfamily TPR-like 9.86e-33
Family Tetratricopeptide repeat (TPR) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|77164418|ref|YP_342943.1|
Sequence length 246
Comment tfp pilus assembly protein PilF [Nitrosococcus oceani ATCC 19707]
Sequence
MLLGFAGCASILSSQEQDIPSIDKEKAAKINVQLGVEYFKQGELEQALKKLERAIQQDPK
LPSAYNALALLKQRLGQAEEAEKYFQRAIKLDPEYSEAQNNYGVFLYNQGHYGDAEARFL
EAVKNPLYGTPELAYENAGMAAQKQVEFDKAERYYRKALQLEPRLPKSLYHMAEISFEKG
HYQRAQEYLQRYRVGARHTPKSLWLGIRIERELGNEDTVSSYALLLRRNFPDSPEAKLLQ
KSLDRQ
Download sequence
Identical sequences Q3JCN3
323261.Noc_0901 gi|77164418|ref|YP_342943.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]