SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77164576|ref|YP_343101.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77164576|ref|YP_343101.1|
Domain Number 1 Region: 253-484
Classification Level Classification E-value
Superfamily HCP-like 2.51e-30
Family HCP-like 0.019
Further Details:      
 
Domain Number 2 Region: 638-1129
Classification Level Classification E-value
Superfamily Porins 2.6e-24
Family Ligand-gated protein channel 0.052
Further Details:      
 
Domain Number 3 Region: 445-585
Classification Level Classification E-value
Superfamily TPR-like 0.000000000379
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|77164576|ref|YP_343101.1|
Sequence length 1129
Comment TPR repeat-containing protein [Nitrosococcus oceani ATCC 19707]
Sequence
MRLRFSVLGIALFVFGFSWVGADERCASPVAQIVSLQGRVEVTPVDERRWRSVGLREKFC
AGDRIRIEAYSRALVQLQDNTLLHLDGGTLVTFSGIEPNKPSWFELLKGAIHLISRFPHR
LEVKTPFVNAAVEGTEFAIRVEPEKALLWVFEGRVLFHNPTGQLTVTSGEAAVAEAGQAP
RRRLVIQPREAVQWALYYPPLIDLRPSVYPSGPEAQGIHVALRAYRDGDLLTALGRLEQV
PIGAREASYFTLQAALLLVVGRIDEARPNIQRALQLDPDHGTAYALQAIIALAQNRKEDA
LRLARQGAKLDPQSSIPQIALSYVYQGRFNIEQALQHAQQATELFPGEALAWARVAELQL
SLGDLDGAAKAAQQAVALDPDLARTQTVRGFAELTAIDIEEAKASFQRAIELDPADPLSR
LGLGLAKIRQGDLKAGTEEIEIAASLDPNNSLIRSYLGKAYYDQKRGEAAATELAIAKEL
DPNDPTPWFYDAIRKQTTNRPVEALHDMQKAIELNDNRAVYRSRLLMDQDLAARSASLGR
IYNDLGFQQRGLLEGWKSVNTDPSNYSAHRLLADNYAALPRHEIARVSELLQSQLLQPLN
LTPVQPSLAESNLLLLEGAGPSGLAFNEFNPLFTRNRLALQASGVFGSNDTLGDEVTQSG
LWKNFSYSVGQFHSETDGFRENSDFARNTYNVFTQGALSPNTNLQAEFRHDERIQGDLAL
RFDPNFSKVLRETSRVNTYRLGARHAFSPNSQIIASLSYQNVNVKQKTQTQRTISIPTPL
GPLETEILIPTEATINRNGFIGELQHFYTNEKATVISGFGHINNDVIQNVTFPENKPPLT
EVITHPDIRKVNIYNYSQIRAFDKLTAILGLSIDSLEIRGQLDKTQVNPKFGLIWMLHSS
TTLRLAGFRSMSTTRTANQTIEQTQVAGFNQFFDDVNGTDAWRYGAAVDHVFSKYFYGGV
EYSERKLDVPVLISQGSKAQFVNWKEKTSRTYFYLTPNSNFAASIEYFFERFDRRSNPLR
TGIVDVATHRVPVGLSFFHPLGFSANLKATYVNQSGFFQRRNSDDIFNDQSGFIVVDMSL
NYRLPKRFGIIRVGSKNLFNERFKYQDMDPNMPLFFPERFLYTQLTLAF
Download sequence
Identical sequences A0A0E2Z4C4 Q3JC75
323261.Noc_1063 gi|77164576|ref|YP_343101.1| WP_002810207.1.20919 WP_002810207.1.77844 WP_002810207.1.91979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]