SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|77164961|ref|YP_343486.1| from Nitrosococcus oceani ATCC 19707

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|77164961|ref|YP_343486.1|
Domain Number 1 Region: 171-326
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.23e-33
Family Glutathione S-transferase (GST), C-terminal domain 0.015
Further Details:      
 
Domain Number 2 Region: 41-99,126-163
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.66e-16
Family Thioltransferase 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|77164961|ref|YP_343486.1|
Sequence length 334
Comment hypothetical protein Noc_1469 [Nitrosococcus oceani ATCC 19707]
Sequence
MGLLVDGQWQDQWYDTKSTGGRFQRSESQFRNWVTADGAPGPSGTGGFEAQSGRYHLYGS
YACPWVHRTLVMRAWKGLEEHIGLSVVHPLMLENGWELREDFDGATGDTLYGLDKLYELY
LKADNRYSGRVTVPVLWDKQQETIVSNESADIIRMLNRAFDDRGARPGDYYPEDLRESIE
AINETVYDNINNGVYKAGFATSQEAYDEAVTVLFDTLESLEQRLGESRYLVGNTLTEADL
RLWTTLLRFDPVYVTHFKCDRKRIRDYPNLDGLLREIYQLPGVAETVHMDHIRNHYFRSH
PTVNPNGIVSIGPELDLSAPHGRDRLGERIVRGA
Download sequence
Identical sequences A0A0E2Z2F6 Q3JB40
gi|77164961|ref|YP_343486.1| 323261.Noc_1469 WP_002809253.1.20919 WP_002809253.1.60716 WP_002809253.1.77844 WP_002809253.1.91979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]