SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NCU04674T0 from Neurospora crassa OR74A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NCU04674T0
Domain Number 1 Region: 264-441,559-725
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.34e-72
Family YicI catalytic domain-like 0.0068
Further Details:      
 
Domain Number 2 Region: 34-262
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.16e-52
Family YicI N-terminal domain-like 0.0041
Further Details:      
 
Domain Number 3 Region: 727-809
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.65e-20
Family Putative glucosidase YicI, domain 3 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NCU04674T0
Sequence length 928
Comment | NCU04674 | Neurospora crassa OR74A (finished) alpha-glucosidase (929 aa)
Sequence
MFAGSRLAALGLLASVCSAALPQASRAINNNSLAKCPGYKATNVKTNANGLTAELKLAGK
ACNTYGTDLDNLVLEVTYETDNRLHVKIQDATNDVYQIPESIFPRPQAAQGANSKKSALK
FTYKTSPFSFAVTRAKTGEVLFDTSAASLVFESQYLRLRTKLPNNPNLYGLGEHSDSFRL
NTTNYIRTFWSQDAYSTPNGANLYGNHPVYYEHRKSGSHGVLFLNSNGMDVVIDKDSRSG
QYLEYNSLGGVVDFYFVAGPSPIEVAKQYAEITKLPAMMPYWGFGLHQCRYGYQDAFEVA
EVVYNYSKASIPLETMWTDIDYMDRRRVFTLDPQRFPLSTMRQLIGHLHENDQKYIVMVD
PAVSAAEGPENPALTKGIEENVFLKRNDSSIYKGVVWPGVSVFPDWFSANISRYWDSQFT
EFFSASSGINIDGLWIDMNEPSNFPCFFPCNDPEKSAIGYPPEPPAVRTPPRELPGWPCV
FQPEGTECKEKKDLTIEAPVKSDILIAKREETVEASITAGKQLGLPGRDLLFPKYSIHNK
AAYMDSWNADKGGLSNKTVNTDTIHQNGLAEYDVHNLYGTMMSIQSRGAMLARRPGLRPF
IITRSTFAGAGHSVGKWLGDNIADWQHYRESIYGMMAFASIYQIPMVGADVCGFGGNTTE
SLCARWAMLGAFSPFYRNHNEYLPSISQEFYRWEIVAEAARKAIDIRYRLLDYIYTAQYK
QSVDGTPMINPMFYLYPNDANTFGLQHQYFYGPGLLVAPVTEENSTSVDVYLPNDIFYDW
YTLDVVHGKGRTVTVKDQSLTDIPLYLRGGVIVPLRAKSAMTTTELRKQDFELIIAVGKD
LTAEGELYLDDGVSLEQQGVTNIKFKYALGVLTVNGDFGFKTDVKITNITVVGALGKKSV
DVNIPLTQACTAVLCEGTGGIVKKMCYE
Download sequence
Identical sequences F5HHN2 Q872B7
XP_959217.2.24337 NCU04674T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]