SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NCU09424T0 from Neurospora crassa OR74A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NCU09424T0
Domain Number 1 Region: 59-372
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000000823
Family Galacturonase 0.051
Further Details:      
 
Domain Number 2 Region: 429-547
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000000144
Family alpha-D-mannose-specific plant lectins 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NCU09424T0
Sequence length 548
Comment | NCU09424 | Neurospora crassa OR74A (finished) hypothetical protein (549 aa)
Sequence
MKILFRALALPLSFHFLSLAHAIPSPEAAHGGSSQATNTTDDAMTITPRQSSCLSTGTQS
TINALFSSGGANTIVSLCPGVTIPITAPIVFTAPGQELSTQGYPTDSTRATILIQPGSTV
TSAIRGNWQNNVKVLNIQVDGNRPNAGYLGGDALLEMGGGTEGQTVSHTVVKNTRSWSCV
HFIGSGQEDNPCRQATVTFNEVGPCGHEGTDPATGNGLWADGLSIECMDTTVTDNIITGA
TDGGIVIFGSPGSHILRNTITSSSSSGLQFGGINMVDPTWSGNYSGVVVSSNTITGGPGS
FINLGIGMGSQVWSNPHPETNFGQVTVTNNVFTGNVGFSIVMNGWLGGLTVTGNSVSGVT
TPSSSFASASGCGAVQQAAFADSEQLVYYPAGVTGSSGPNVIQSQFTALSTNASNWLCLT
NPAPPLPDTESFLPNTLSVDASTSRVVSLRDFHVQVQGDGNVVGIDTTGGVWTVKWASSR
FSSACGQDGSQCLLAFGIDGNFVMYDGNGPLWASGTDGSGQLLTFSREAPWVTVTGSNGQ
TLWTIGNM
Download sequence
Identical sequences A0A0B0E618 Q7S0S3
NCU09424T0 XP_958164.1.24337 5141.NCU09424.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]