SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TA07875 from Theileria annulata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TA07875
Domain Number 1 Region: 52-253
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.36e-38
Family Nuclease 0.07
Further Details:      
 
Domain Number 2 Region: 240-429
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.36e-27
Family Nuclease 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TA07875
Sequence length 486
Comment |||cardiolipin synthetase, putative|Theileria annulata|chr 04|||Manual
Sequence
MFKFYDKKNNFNPSLDIDSFIYNIDSLNSKNYSNLKYFSASEITKWNGILTSLSSNFGKM
SPGNIVHIFQDGNETLTDMLKEINKAKESVFLEMYIFDDSPVAEIFANALKNAALRGCKI
VLLLDYIGSIRFSSKIQRELEEVGVKIHFFNPLRLNNSIGPVTFRNHKKLLIIDQKTAYC
GSLNICKSSVGEDLGGDGGYIDVNVRINGPSVYDLCMSFLESLKIAKVNTDDLKFSERSE
PLPGGSIVQIFESNTRKNKKDVLNSLLLVISKASNSIHLSTSYFIPPGSLRRSLISAKNR
NLNIRMLLSGNSDLPGDTSSTYYILKKFFVPHNHPVLLIRSRFAKPIGNNFKVFMTRNRH
YHGKVMVVDDIWSSIGSFNWDRLSSRRNMEITLGIFDPLVAHKLKQVQLENEKESYEYTR
NHSLNRMKILKMYDCITYHIARFSEGNLVDGLSNERFNVVFKKTFIRTFVDQNVSEMFLT
SNISSV
Download sequence
Identical sequences Q4U9X9
TA07875 5874.Q4U9X9 gi|84996555|ref|XP_952999.1| XP_952999.1.9581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]