SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|122949|e_gw.195.33.1 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Nemve1|122949|e_gw.195.33.1
Domain Number 1 Region: 1-133
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.26e-24
Family Ankyrin repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|122949|e_gw.195.33.1
Sequence length 142
Sequence
PLHRACRDGDIQSLTYLVIQGDRLGVFRAINEPDQFLMWTPGHWAAYFGKLPCLKRLQQS
GYSLDVAEGRLKQTVAHLAAFAGHVDVLHWLLENGVSLDKQDSLGETVVHKAVRGGSVEC
LTLLQHYGAPMKLVSFLLEMRC
Download sequence
Identical sequences A7SLQ9
jgi|Nemve1|122949|e_gw.195.33.1 45351.JGI122949 XP_001627457.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]