SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|127426|e_gw.237.46.1 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Nemve1|127426|e_gw.237.46.1
Domain Number 1 Region: 6-166
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-52
Family Protein kinases, catalytic subunit 0.00000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|127426|e_gw.237.46.1
Sequence length 169
Sequence
NPKTEFTLADQVVDAYQIAQGMDFLASKKCIHRDLAARNVLVDEGYALKIGDFGLARDIY
KTDLYVKKGAGLLPVKWMAPEALFDREYSSKTDVWAFGVVLWEILTLGGSPYPGVPLEQL
LDYINEGKRMAQPRDCPPEIYAIMCDCWSLEQDRRPTFAELVRRIERIL
Download sequence
Identical sequences A7SQB4
45351.JGI127426 XP_001626187.1.94760 jgi|Nemve1|127426|e_gw.237.46.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]