SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|197019|fgenesh1_pg.scaffold_4000099 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Nemve1|197019|fgenesh1_pg.scaffold_4000099
Domain Number - Region: 432-499
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0022
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|197019|fgenesh1_pg.scaffold_4000099
Sequence length 1108
Sequence
MSSLSLLALSLITNLSLGMVKGSFLPYDFAKSGQIETVVFTAANRETESFGQLYLAGSRM
EVFCQLRYRTIQDTNETRRELVDRFALNGMRPRITFSNMTRNSSFEFNEFVVDENGAYWK
VNISKSEISQDNFSLDSSEAWQYYAELGKGLNLFESSGTLVVKELEPLLNLQFGDEVHGP
ISVISPPYGAVIRHSACSPGVSAIVPLLDTSIKQFSGCFLGVTYSYFTPSSMKWYNLLHL
SASEPDLFSICKKPLFSECATLSILDFAVLKNQMIVITSQGMLVSQIFTEALEMARGQKV
TFSRVSQVYPPLDKDMELGILQKDQVNFHYTAHCHDLFISKHEEVLCLVYNSLQSPSNGS
VLLCSSSPFTTWTDMTPRSYRDKHLKVLGVGHDIQRDRVTLLVRDITKGDMRVEIFDSDT
QKVSGPPFHVDPEDNATRIYVHPFDSVLFVYGSQVWKSLDGGNSFHQVSDLDSDDWVTSF
SCDFYGETYSFTTRLGTIYTGKTGIHRVRPIKSGDSGPRLKGIVGSIVVEQARSVLTLHF
HADNGELILQHNNFEITDSTNLPITSFSSMMLRILSETTMEFFPLCYSALSKCGNLFDPT
HVGQVIHSSYGGSAIIARLKKSVHGSRFEGSVIAEVIEPFQELQDDVTNHPLSVSFHGEN
ATLKLADAEWRAEDKGRTIILPNGLSFIVLDEINSTTVIAVSHFHWTRGKGLQETYTGWT
LYDFSSSKLANTSWWLEEDVCRSVLISSREGDAQFIHLDSRDNLSLVVSVISKVLSGEWP
SVRALPKLLIGNSKLFVVDSSYSLGHLNNSLNLFIKQRPQATGSSSLTVFIEESSLLCRS
SSFTIAVHSGCPPSKMLHFIYPFTASEDALLASTVKDTLGVVRNKKLPYNYRPPSARGVG
IPMTANVYHADPARPQYRDAFVVTRSTYRYKQCKGKAKRSHCGCTRATKVSSLVQHSDCI
EVVYRLLFDEKLTPRFLVLREGREAETLTSPYYLEELNNRSDFEIVNSSNKTVLQQAVVM
EQAKNSSIYFYGSGLFHFRAFAVQENYTFCDLEAEFLVFVDETPLPYPAKDIIRACTAMG
FFTLLYVLYLWNFHFRHNIINELEETHK
Download sequence
Identical sequences A7RH07
jgi|Nemve1|197019|fgenesh1_pg.scaffold_4000099 XP_001641202.1.94760 45351.JGI197019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]