SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|202576|fgenesh1_pg.scaffold_36000053 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Nemve1|202576|fgenesh1_pg.scaffold_36000053
Domain Number 1 Region: 439-581
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.3e-32
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00039
Further Details:      
 
Domain Number 2 Region: 152-311
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.25e-32
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00041
Further Details:      
 
Weak hits

Sequence:  jgi|Nemve1|202576|fgenesh1_pg.scaffold_36000053
Domain Number - Region: 612-707
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0034
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|202576|fgenesh1_pg.scaffold_36000053
Sequence length 716
Sequence
MPAQMPEPLRTASETIFNLWSTYTYHTLVKHSPQISADAKGVHVTWMLAPFLSFQDVTSY
KWQRPRVEKEEGHSTFVIPTLQWMQEIEFTFSVMFDHDRKLKPGRHHVITPVHMHYYKDY
TEDARGLVLSKGQYFSQPLATVEFVLEVPVKCISPLGMESGQIPDEALTTSVPNDYQGGV
SKAANGRLNKVVTSYPNGWAARMQASNDYLQIDFGSLRKVTRVAIQGAYSGSRDVRFFTK
AYTLSSSRTGLAWTGYTEDGTLKNIKGPSDSGAAKWPLLYKLKKPIVARYLRIHPTEMMI
IPVLRAEVYGCLSEPLPLYTGNPYIMPQEPKIEFQLSYQNVNASMTSGSTYTYHTLVKHS
PQISADAKGVHVTWMLAPFLSFQDVTSYKWQRPRVEKEEGHSTFVIPTLKWMQEIEFTFS
VMFDHDRKLKPGRHQGSGCSTPLGREIADYQITASSSYLDAQPTQARQSDDAWCAFVTND
QQYIQVDFPRKTRITQFVTYGRRTKLMWVTQYSLQYSDDETNWKDYTENGHIKELSGAKD
ASEAKYAVMVKLAQPFLSRYMRIIPTKANTLKIMRAEVYGCMAEPTSPYEDLRAVACQPL
MERNGMLDEYIIGVIAAHPDEHEVFGIDASMNFFVSRDRGASWSVISSKHFRSVQKATAL
IMASGVPDNLVSDTPSSMSAVSSKGTKWGVSGLGIHMMTAGSSTWDIVGSWRCCGV
Download sequence
Identical sequences A7RV35
XP_001636743.1.94760 45351.JGI202576 jgi|Nemve1|202576|fgenesh1_pg.scaffold_36000053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]