SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|209600|fgenesh1_pg.scaffold_108000042 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Nemve1|209600|fgenesh1_pg.scaffold_108000042
Domain Number 1 Region: 47-279
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.16e-51
Family Pancreatic lipase, N-terminal domain 0.0000112
Further Details:      
 
Domain Number 2 Region: 482-628,659-722,771-811,842-994
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 4.19e-45
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0053
Further Details:      
 
Domain Number 3 Region: 280-382
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 0.0000000000000139
Family Lipoxigenase N-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|209600|fgenesh1_pg.scaffold_108000042
Sequence length 1176
Sequence
MNICIVSRHVEKLYSESMATSLTNTNIHIVISLSKAVDSIIDLKGWWGIRMKDELLRKSD
DNVIIVDWIRGAKIPYVRAVANTRLVGAQVAAFMKTILSLSGSREGGAFHSIGFSLGAHI
SGYVGQRLKRIGRHLDRITGLDPATLMFKGEAPDVRLDRLDAQFVDVIHTSYVFGITAPH
GHMDFYPNGGTSQRGCSLWDGMEGVVCHHIRAAEYFIETINPKSCPWRSYRCGSKDEFDR
GKCMSCASGCPSMGYKADKFKHLIPGMFYLDTAGRSPFCVFHYRITFYTDDSYWPASLDA
HAYVKLGGDLGSTGEIKLIERKLEENSVESFVARASIYLGKLQHVTIYHKHLAEFWKVKK
VVVRAGWSNDIYTACFNEWIHYKNHTQKALTRGRDGLSGFRHAKDVFERRDIDSLNHLTK
RDTAEEIYIPVNSHRTKRSDPSSVDLTDKTCPADPSLSKGKTIVNDEFIFTNESRLSISM
SWVGSDFKTILLLATSEMLIFATQRSALYKSSDFGKTFKQINTDIFNAHIRRNFGIQKSP
VDPNRVILVSYSLPIFGKFSTLYVTMDGANSWKSFQAPFQISGAIEFHPRNNNWILARSN
LLSQGAFLSTNFGRSWTRLRSYVMSAKWGARHEFKVEKEESSILLTVAPVENVLVKHCYT
FGIQGPFLFVSVDLNKNNRTRIMHVSTDGGDTFDKAGVPSIFPEQFYSILDMSEGMVFLH
VDSPQDTGKGALYTSDADGIVFDKSLENHVYTNFDAATDFYKVESMNGTYITSIMNADNS
ISTVITFDRGGEWKPIPLDQNKLCKGIKFNQMLPQEQEALGFVATLKLLSPQSSEPQVPR
KDQSCSLHIHYRFSLSRGVPGMVQGPLSESNAPGIIIAHANPGAALMAANIGIWVSRNGG
YDWKQALKGPHYYSIADHGKLIVAVPATASGTSDLMYSVDEGACWYRYQFTETNLVFTGL
VTAPGARTLRFSIWGYTLPNKTWRVITVDFEKLLTFKCLNSDYESWVPHGSGKNEGCLLG
RKVTFRRAKPDSLCYNGEDFVGMTAMDHCSCTMADLECEYGFYRKVGESECKKDPTKKPK
LCIGGEQEDITDRGYRRIPGDVCEGGLPDKAKYLDAHKRCFNSSYYYYGMEKMQNDRPKP
QGHKTNVTAAVVVPIMLIALGICVYFGKKFWDVKKL
Download sequence
Identical sequences A7SB80
45351.JGI209600 jgi|Nemve1|209600|fgenesh1_pg.scaffold_108000042 XP_001631131.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]