SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|223282|fgenesh1_pg.scaffold_2527000001 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Nemve1|223282|fgenesh1_pg.scaffold_2527000001
Domain Number 1 Region: 5-199
Classification Level Classification E-value
Superfamily Recombination protein RecR 4.32e-65
Family Recombination protein RecR 0.00000468
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|223282|fgenesh1_pg.scaffold_2527000001
Sequence length 205
Sequence
MDFSSKLLENAVNEVSRLPGIGKRTALRLVLHLLKQPAEHTGYLAEAITQFRTTIKSCEK
CHNISDTVLCEICNNPNRNSEIVCVVEDIRDVMAIESTAQFRGLYHVLGGKISPIEGIGP
HNLQIESLVEKVANGEVKELIFALSSTMEGDTTNFYIFKQIEKYNIITSTIARGISVGDE
LEYADEVTLGRSIVNRIPFEQSIKG
Download sequence
Identical sequences A7T784
jgi|Nemve1|223282|fgenesh1_pg.scaffold_2527000001 45351.JGI223282 XP_001620267.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]