SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|242499|estExt_fgenesh1_pg.C_650040 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Nemve1|242499|estExt_fgenesh1_pg.C_650040
Domain Number 1 Region: 149-176,224-270,407-448
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00000000222
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|242499|estExt_fgenesh1_pg.C_650040
Sequence length 743
Sequence
MDVLPRQFAGLAIFLVFVSVNSYRFSIPTNLFTQGPVDSSLEPEGLREIRALSLDEETDE
HDEERKLHQRFRRASVQPSEPIIIEVNGILNHEGTLGFWIIVKIAYLLTYSVFSYFQSDL
KGETRNIFYMYWPGNAAQDKNILLLAKNEQGPPKPIIYLSTNFGKNWTNINSRLQLKNRR
SQGSVDQIYVSKLNPRLCLLADATNKHLFLARDFQNFVAIQLSWTPSFLSFHPTKAEIIA
GYDKLTKKLYLSRDQGVSFTEIQDSLKAFWWGVPDVDEYSIMFFEVYKSQAKDSQSTAYK
YDFLTVNRIKLLDYVDEFEVMQKYCFATLTKTEGDKKSTEFLVSYKRGNFKPTKFPVKEH
SRMLADRSTLCPWREYFITTRTLMSPPLGLAFMFAAYELVIRKRLSDLAFRESPVYSLCT
GSCYGSGYSTNGGNNWTSIPFTSPQNKVLVEDIMTQAEEKLPIFILYGSTIKDNKKQWKL
FHINLTSVLGSPCQASDMQLWVPSDDRAGLERCILGEQVEYKIRNWTKTCLMGKDYEAGK
VVKSCTCRRVDFECPQNKVLVEDIMTQAEEKLPIFILYGSTIKDNKKQWKLFHINLTSVL
DPEKIVHIAEENGAKIGEPTQASIDVQLMLDAMRQGFERISKTLVSSSSDTANAISEAFD
SLEGEPEVGYEDESYHGTENHEGENPPSKKRCTESATHDESSQAEKSPDFDSLLEKKTPA
SNEGERDVLKELKKRPPKGGNKS
Download sequence
Identical sequences A7S315
45351.JGI242499 jgi|Nemve1|242499|estExt_fgenesh1_pg.C_650040 XP_001633942.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]