SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|3368|gw.1510.3.1 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Nemve1|3368|gw.1510.3.1
Domain Number 1 Region: 2-139
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.15e-28
Family Ankyrin repeat 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|3368|gw.1510.3.1
Sequence length 148
Sequence
NQDASGLTPFLYTMKANRRECGRILIEKGADVSAHTLEAENCLHLAIMHQNVELVSMILE
SSVGCKLIAQSGTRLERTPLHYAALNGGTLTVGLFLSRGSRVNELDDEGNSTLHXACSTV
HVEVIKLLLDHGAEILMNNQEMNCLEVA
Download sequence
Identical sequences 45351.JGI3368 jgi|Nemve1|3368|gw.1510.3.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]