SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|90077|e_gw.23.232.1 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Nemve1|90077|e_gw.23.232.1
Domain Number - Region: 157-298,338-380
Classification Level Classification E-value
Superfamily Cell wall binding repeat 0.0188
Family Cell wall binding repeat 0.028
Further Details:      
 
Domain Number - Region: 22-259
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0288
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|90077|e_gw.23.232.1
Sequence length 436
Sequence
MPITALGPFSISPGVQYVFHPNGVQYVTQPNGVQYVTHPNGVRCVTHPNGVQYVTHPNGV
QYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTQPNGVQYVTHPNGVQYVTHP
NGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTQPNGVQYV
THPNGVQYVTHPNGVQYVAHPYDVQYVTHPNGVQYVTHPNGVQYVTQPNGVQYYVTHPNG
VQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTH
PKDVQYVAHPNGVQYVTHPNGVQYLTHPNRSQYVTHNNGVHYVFYTNGVQYVTHPNGVQY
VTHTNGSRYVTYPNGVQYVTHPNGAQYVTHPNGVQYVTHPNGVQYVTHPNGVQYVTHPNG
VQYVTYPNGVQYVTHP
Download sequence
Identical sequences A7RQS0
XP_001638279.1.94760 45351.JGI90077 jgi|Nemve1|90077|e_gw.23.232.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]