SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|93849|e_gw.34.106.1 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Nemve1|93849|e_gw.34.106.1
Domain Number 1 Region: 21-127
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-20
Family SH2 domain 0.00027
Further Details:      
 
Domain Number 2 Region: 136-185
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000017
Family SOCS box-like 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|93849|e_gw.34.106.1
Sequence length 186
Sequence
MLPSPTVNRAHWDKSTVVGPVLDTLRQSGFYWRGITKEQADIILRSCDMGAFIIRDSSSP
NFLFTLSVRTVFGVTNIRIAMDRGRFSLESIDNENSEGPSFKCVVHLIYYYVKNSRHSER
HLEDNYLRREPTKYKLYLGRPIYGAVSSLQHLCRRSINKQMRPNGVYALPIPAKLKIYIS
NYQYPI
Download sequence
Identical sequences A7RUJ8
45351.JGI93849 jgi|Nemve1|93849|e_gw.34.106.1 XP_001636929.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]