SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|102625|e_gw.65.24.1 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Nemve1|102625|e_gw.65.24.1
Domain Number 1 Region: 671-866
Classification Level Classification E-value
Superfamily Sec7 domain 2.35e-72
Family Sec7 domain 0.00000264
Further Details:      
 
Domain Number 2 Region: 80-151,406-551,931-966,1169-1519
Classification Level Classification E-value
Superfamily ARM repeat 8.38e-20
Family MIF4G domain-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|102625|e_gw.65.24.1
Sequence length 1833
Sequence
MYESTRTKNMFLTRALEKILHDKEAKKSYNSQLRKACEVALINDLLCFLSDNSSSALPPP
KGLLPFVEAEKYLLPFELACQSKCPRIVTTSLDCLQKLIAYGHLAGDIPDATEPGKRLID
RIIETICSCFIGVQTDEGIQLQIIKALLTAVTSNTCEVHEGTLLQAVRTCYNIYLASRNL
INQTTAKATLSQMISVIFQRMEAQAISYRKQVVANPSRQSSHYKLMRQIRKMFPKRPGIR
MRMREKTENDSSVHEDDPNSCTAESTQSSAGDVKETEEVQYAQAQNSGHAENITSSLSEP
PGESTSHMSEHPEQDTEQAKDATSNSAEHPEDPSSQSAEHPEDHSPHSAASVENSSSSQH
LEHNSTTHDDNQSVSSHISDHDHDHEEGKGDGRGTDGHPGGPVKFSHVTQKDAFLVFRSL
CKLSMKPLADGPLDPKSHELRSKILSLELLLSCLQNAGPVFCNHEMFITAIKQYLCVALS
KNGVSSVPSVFELSLAIFLTLLSSFKTHLKMQIEVFFKEIFLNILETSSSSFQHKWMVMQ
ALTRICSDAQCVVDIYLNYDCDLSLSNIFERLTSDLSKIAQGRQAIELGATPVQEKSMRI
KGLECLVSILKCLVEWSRELYINPNSQVAVGEDKDSTSGSSGLGSELKSFGGSQGSLNSN
SAASGITPDNPEQFESLKQMKGLMEQGIAKFNKNPKKGMKFLQENGLLGMSAGEVAEFLH
GDERLDKMQIGELIGDNDDFSKQVMYEYVDKLDFTDMEFVSSLRLFLTNFRLPGEAQKID
RLMEKFASRYFDTNPNNSVFASADAAYVLAYSIIMLTTDLHNPQVKRKITKEQYCSMNRG
INDSKDLPQEYLEGIYDEIQHNEIKMRTAPKSANRYSTIYLQNEKSRRMLYYQEMEQMAQ
TAKSLIEGVSHVQTTFTSATHVEHVRPMFKVAWTPFLAAFSVNLQHCDDPQVASLCLDGI
RCAIRIACIFGMQLERDSFVQALSRFTLLTASSSLHEMKTKNIDTIKTLITVAQTDGNYL
GHSWHEILKCISQLELAQLIGTGVKTMGASTSSSAHSTHNSKPVSAAARFLGNRNGARRL
GHTILPYYLEILGFLGNKNIVLPCSCFWIFTGSTKLDGEAIVDFVQALCMVSSEELSSHA
HPRMFCLTKLVEISYYNMGRIRIEWSHIWAVLGEHFNKCGCNPNEDVSFFCVDSLRQLSM
KFLEKGELPNFRFQKDFLRPFEHIMKKNRSATIRDMVVRCVANMVHSQAHNIKSGWKNVF
SVFHLAASDVDEGIVELAFQTTGMLISTIFEKYFSATIDSFQDAVKCLSEFACNASFPDT
SMEAIRLIRNCAKYVYENPEMFKDHSSEDGVVSEADRVWVKGWFPVLFELSCIINRCKLD
VRTRSLTVMFEIMKNYGHTFPKHWWRDVFRVVFRIFDNMKLPDQQVDWAEKAEWMTTTCN
HALYAVIDVFTQYFDVLSDVLLDDMFVHLLWCVQQDNEQLARSGTNCLELLVVSNGKSFT
PEMWEKTCTCIKDIFKSTLPQELLTWRPDMYTMNAHDHTPSHSPTQDSERDDISVSSLPM
VKFEPTDTNHAHQQRNLCFVQALSCCVTDVSVQGSSAEELFTALLIKCVVQLELIQTIDN
VVFFPATSKKEDAENWDAARNDHFFRSRQDSSLQMSDGMFQFLSSEQLFLFIGCLEDSHT
FAKLFNSNNEQRTFLMKAGFKGRSKPNLLKQETSSLACLLRILFHMYLDNTRQDAWPAVE
EMTIRICKESLMYYLSLESSSHREAWTSLLLLFLSRILRLDDERFKIHASTYYPLLCDML
LLDSKVELRSVLRAVFQRIGPTFGICQIPAHSS
Download sequence
Identical sequences A7S350
jgi|Nemve1|102625|e_gw.65.24.1 45351.JGI102625 XP_001633965.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]