SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|174876|estExt_gwp.C_3380042 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Nemve1|174876|estExt_gwp.C_3380042
Domain Number 1 Region: 189-464
Classification Level Classification E-value
Superfamily Mitochondrial carrier 4.32e-80
Family Mitochondrial carrier 0.0000334
Further Details:      
 
Domain Number 2 Region: 15-181
Classification Level Classification E-value
Superfamily EF-hand 1.94e-34
Family Calmodulin-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|174876|estExt_gwp.C_3380042
Sequence length 471
Sequence
MADDSDSQHYKSDPKRVEELFKELDKNQDGKIDVNELAEGLKKLHGPRYKPGQAQQIMTL
GDETLDGHLSFEEFVNYITSHEKKLWIVFKSIDLDDSGSVDASEIKRAFEKMDMKVTQQE
VDLLLKRMDKDKTLKVNWNEWREYHLLNPSGHSMHDIIQFWRHTIYLDIGEDMLVPDEFT
EAEKRSGMWWRQLVAGGGAGVVSRTATAPLDRLKVLLQVQASSTNRFGIVSGFKMMLREG
GIKSLWRGNGANVIKIAPESGIKFFAYEKAKKLVGSDTKALGVTDRLLAGSMAGVASQTS
IYPLEVLKTRLAIRKTGQYRGLLHAASVIYQKEGIRSFYRGLFPSLLGIIPYAGIDLAVY
ETLKNFYLNYHKNQSADPGVLVLLACGTASSTCGQLASYPLSLVRTRLQAQAREKGGGQG
DNMVSVLRKIITEDGFKGLYRGLAPNFLKVAPAVSISYVVYENLRLGLGVV
Download sequence
Identical sequences A7SVT7
45351.JGI174876 jgi|Nemve1|174876|estExt_gwp.C_3380042 XP_001624285.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]