SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|207020|fgenesh1_pg.scaffold_76000004 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Nemve1|207020|fgenesh1_pg.scaffold_76000004
Domain Number 1 Region: 114-343
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000000782
Family Choline kinase 0.093
Further Details:      
 
Weak hits

Sequence:  jgi|Nemve1|207020|fgenesh1_pg.scaffold_76000004
Domain Number - Region: 6-72
Classification Level Classification E-value
Superfamily DNA primase core 0.0194
Family DNA primase DnaG catalytic core 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|207020|fgenesh1_pg.scaffold_76000004
Sequence length 390
Sequence
MADATEVFDDNLFRKIVESKGKLVSFRAREIDNKSGRLSNLCKHNVYPVGHFLYDVTYTT
PHGNEKTMLIVLKAKAAGRVTVDAINGLAQKCGNPVSTVFEKYKNQLGYCFTDMRELEVY
KITDQRFTRITPEVYYINSNPEKEMFIIAMEYLGTPCVTLMNRMDDAPDVWTKKYIEIAL
RDIAGFHSIHLDGVDSLLKKPYIEAFTRKKMVELTDLWQALADNARLKAPDVVTEKRYKI
WKHIIHIIDHIWKELESSPRTLIHNDFNARNACIRLSIQSTAPRPEYVERPDYACDHLCL
YDWECSTVHVPQSDIAEFLAFTLAEDTEPSVGEQWLEFYRVELQRHSGNDFNCESCGVGD
DDSCGDGGDGCDGDDKGDDSGGDNSDGVGR
Download sequence
Identical sequences A7S596
XP_001633111.1.94760 45351.JGI207020 jgi|Nemve1|207020|fgenesh1_pg.scaffold_76000004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]