SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|210187|fgenesh1_pg.scaffold_118000019 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Nemve1|210187|fgenesh1_pg.scaffold_118000019
Domain Number 1 Region: 769-849
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000225
Family PDI-like 0.052
Further Details:      
 
Domain Number 2 Region: 64-129
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000411
Family PDI-like 0.037
Further Details:      
 
Domain Number 3 Region: 679-753
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000598
Family PDI-like 0.048
Further Details:      
 
Weak hits

Sequence:  jgi|Nemve1|210187|fgenesh1_pg.scaffold_118000019
Domain Number - Region: 1052-1128
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00123
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number - Region: 272-371
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00238
Family Calsequestrin 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|210187|fgenesh1_pg.scaffold_118000019
Sequence length 1139
Sequence
MQWLFAWDRINAYKEMLLEHSGFYRKLKYLQSGDNFVLYPNHPPLFSDEATHVHEISNGS
LQVLSSFLHNSPLNFVFFYAPWCGQSRRAVEEFNIAASLLYGKVTFIAINCWAGSCREKY
TLDSFPKIYSNSDEYGQYITWKVIYNDSSNSDEYGQYITWKVIYNDSSNSDEYGQYITWK
VIYNDSSNSDEYGQYITWKVIYNDSSNSDEYGQYITWKVIHNDSSNSDEYVVIVMSMVII
LPGKSFMMIVVIVMSMVQFLQGVVRPFTYIGRESDFKVLVDQEPEVVISFFKPHELSSKK
YFRFFTVALQHYGHISSPRFAVVTSEEVAKTIGLHSSGNVLFCRAFKPPLVYHPSKGITS
CNITTWIATNRRQAMLGDAASLQNRLCLLSNRAALAMLNDASPMTFMVEEGLYYLILLSK
KAAVILFVPLRRKDVSTPLLRLFTKASLAYHNCSCNKTTSTNTTLHDKHKELESLGTAIH
KIAAKPQQSICRSLQVQTVINAHHTVRNVCDICHRCRKGCSGNHDNRFGAIQARLLGGLA
PRPCSTVLTSYNPSSLVTSVCCKRVDPKTEVVRKGSLFDYENKLSSLIDSIFDNIVALKG
MSQKNDHLNVESIKAMLSDETKRLTELASKEDQAKPKPTAEVHAPTPGNVTAGNVTDDDA
TDGCNRTGHVTRFLGAHCHSNKSVNFFYMDSEEYGIIAERLGVRWGADRVALVIVDVKNE
AQYVFDESRQITNDSLVDFVMKSMTSKLERRLRIPPPSGISCSREIVCVTEVTTDSFDDI
VINNDQDVLLVFYTPWCGMCINFAPVLLAVARFFQDISQVSVTRKDSSIAFPSNTPRTAT
RLIEFIEEHGSEALRVALYGRTDGFNVSEALIARVGELESRLQRVEQEKKLLETRLEAVM
MEKALAAFQSARAIKGMRDSQLESAREHEARVTAERLFRESEKSRAASEEKLFKLALYNN
QLEQALRQKLSELEKNEESLVKLASEAKKVLSEKQELSILINGISKKLNNLKEITSHFEK
RELFLTQKVLRLERASRILTLRAVDYIGRSSKTDEEIVELRRQRNLLTQLVKDAEQTVSG
LQASLSSTRKVLDDVTVERNNAVETGAEVKRQLEEMRQRYEELEQILRNSQIPRKKPAR
Download sequence
Identical sequences A7SCL5
jgi|Nemve1|210187|fgenesh1_pg.scaffold_118000019 XP_001630578.1.94760 45351.JGI210187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]