SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|53623|gw.117.111.1 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Nemve1|53623|gw.117.111.1
Domain Number 1 Region: 79-115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000295
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 2 Region: 6-41
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000336
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 3 Region: 42-78
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000014
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 4 Region: 117-152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000243
Family EGF-type module 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|53623|gw.117.111.1
Sequence length 152
Sequence
LAFTAPCSSNPCQNGAACTESAWGYSCACPSGYTGANCETTSPCSSNPCRNGATCTESGG
GYSCACPSGYTGANCETTSPCSSNPCRNGATCTESGGGYSCACPSGYTGANCETTLACSS
SPCQNAGSCAEKGGGLYGCTCASGYTGANCET
Download sequence
Identical sequences A7SCH6
XP_001630667.1.94760 45351.JGI53623 jgi|Nemve1|53623|gw.117.111.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]