SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|67111|gw.6.455.1 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Nemve1|67111|gw.6.455.1
Domain Number 1 Region: 38-75
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000126
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 2 Region: 1-35
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000196
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 78-114
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000458
Family LDL receptor-like module 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|67111|gw.6.455.1
Sequence length 114
Sequence
CSPAEFTCSDGMCIPREWMCDGTVDCPDALDEIVNCSRCPRHEFECENKLCVPRTWLCDG
DNDCHDGSDEKNCESRRMRTVKCGIEEFDCGNSTCIPLTVLCDGLYDCADRSDE
Download sequence
Identical sequences A7RIK8
jgi|Nemve1|67111|gw.6.455.1 XP_001640791.1.94760 45351.JGI67111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]