SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|84710|e_gw.10.59.1 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Nemve1|84710|e_gw.10.59.1
Domain Number 1 Region: 269-493
Classification Level Classification E-value
Superfamily SIS domain 1.41e-18
Family mono-SIS domain 0.0017
Further Details:      
 
Domain Number 2 Region: 8-268
Classification Level Classification E-value
Superfamily SIS domain 0.00000000000022
Family mono-SIS domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|84710|e_gw.10.59.1
Sequence length 540
Sequence
MAEEAVEPITELSNNLTLDLDTSDPGEIVSKLYQCDKELFDGWNNYPSMLCEDTIHVVSQ
LAKACLRVLKNRGLIVISGCGTSGRLAFATSKKFNALAKSQGSLGANPYDYLISGGDEAL
FSSREIPEDDWEQGQADLIALCKGQANVLYIGVTCGLSAPYVAGQLDYCLDNPDLFTSVL
VGFNPVHMSRKAPIEGWSKTFYDVACKLQDCKNGIILNPVLGPEAITGSTRMKGGSATKM
IIETALFLAHLQVPNTPGGGMNLSPLDLLQEYKHVLHETYSHLKELTEAVSICGESLKNK
GHVYYVSWGSVGFLPLLDAAECVPTFSSNFHDIRAFMDGGFTSLGNKEGQLLSLDISLLE
FENNMLPHVSCLDSVVFVCLSGVHLPKLQEVVIKLSTQQANIIVICLPQLYKDCINLAND
ITYIVLNMGSELVQLVYYESLLELSVKWVLNCLSTGAHILKGKVLQNYMIDLKVSNNKLF
HRAISIISKFGSCSKEDSFKALLKSIYRCDEVNKGIINMVTSQHIRASMAREQVVPLAIL
Download sequence
Identical sequences A7RKP6
45351.JGI84710 jgi|Nemve1|84710|e_gw.10.59.1 XP_001640085.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]