SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Necha2|88285|fgenesh1_pg.sca_28_chr13_5_0000187 from Nectria haematococca mpVI

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Necha2|88285|fgenesh1_pg.sca_28_chr13_5_0000187
Domain Number 1 Region: 6-114
Classification Level Classification E-value
Superfamily Fungal immunomodulatory protein, FIP 4.45e-49
Family Fungal immunomodulatory protein, FIP 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Necha2|88285|fgenesh1_pg.sca_28_chr13_5_0000187
Sequence length 114
Sequence
MATTNDSAVLFYIVASQKKLSFDYTPNWGRGSPNSYIDNLTFPRVLTNKPYKYRVVKAGQ
DLGVRDSYSVQSDGSQKVNFLEYNAGRGIADTQTIQVYVVDPDNGNQYLVAQWK
Download sequence
Identical sequences C7ZE17
jgi|Necha2|88285|fgenesh1_pg.sca_28_chr13_5_0000187 XP_003043654.1.20327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]