SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156538639|ref|XP_001607668.1| from Nasonia vitripennis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156538639|ref|XP_001607668.1|
Domain Number 1 Region: 7-94
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.24e-25
Family Nuclear receptor 0.00022
Further Details:      
 
Domain Number 2 Region: 509-646
Classification Level Classification E-value
Superfamily C-type lectin-like 6.57e-22
Family C-type lectin domain 0.004
Further Details:      
 
Domain Number 3 Region: 369-505
Classification Level Classification E-value
Superfamily C-type lectin-like 4.64e-18
Family C-type lectin domain 0.0026
Further Details:      
 
Domain Number 4 Region: 658-795
Classification Level Classification E-value
Superfamily C-type lectin-like 1.42e-16
Family C-type lectin domain 0.0038
Further Details:      
 
Domain Number 5 Region: 170-338
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.48e-16
Family Nuclear receptor ligand-binding domain 0.0034
Further Details:      
 
Weak hits

Sequence:  gi|156538639|ref|XP_001607668.1|
Domain Number - Region: 788-844
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0012
Family Complement control module/SCR domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156538639|ref|XP_001607668.1|
Sequence length 1166
Comment PREDICTED: similar to GA10225-PA [Nasonia vitripennis]
Sequence
MGRTLPIPVPCKVCGDRSYGKHYGVYCCDGCSCFFKRSIRRGVLYTCIAGNGSCVIDKAR
RNWCPHCRLKKCFAVSMNTAAVQEERGPRSRSKAYSIESNYTWKISANVNNKSPDNANVT
TNIISSQIRESTFTTRNLSKLYVNPELSPLPILGSSIFPSIVTNGEAIQYEVAAQIFLAI
IRGARRHQEFSSISFEEQNTILHKNWAALFLLRSTSWPYVFDNFQSNSNTEKSGLFHLKT
SREAIVALNLDDVEFLALETILLCRKELAESSTTAQTLSKGQEIAIQTLVRHLQGREDRE
RRLIELLLLLPLLTSCCPRELANYLFAPIIGNAALEKTMKPSAFKLLFCIFLASVYGHES
YNQPIVEFYVVDDIQYVFFSQRVTWDEANMLCTTSNARLAVLDNLDKAAAVAKAMSESNI
VMEDAWLGGRRSSSGWVWIENNNITSKKHSIPLKSSVDDFPPWSQEPTRPSKECLAIDRR
LHSHPNFVDLDCRLLRPYICEKKADDAMNSPVPSKWAQVQKNTYTLYHGRVTWTEAVTFC
RSKGTRLAVIKDKNVINVLTNSMTKSRPDFESVWIGARFSYGQWTWLSTGSTLNPLSDST
GYPPWRFGKSEKNYGCLLLDRHLDNRTNFIELACDRKRDFVCEEYPPEELEEWMNEPTQF
SYGNSTFIIYPFDKTWDESRQYCYDRGSILAHIHDAQLANLMVAAMGDHPKAISHIWLGG
LYHSNRSEWKWIHNNEIIPLNAEIDFPSWAHSIVEEDYDSEESLCLNLDRSDHTKPHFYG
LECENKQPFACIINCEEPPAVRNGTWTCIDQNDVKACSLECKPSFLTMGYEKVYCGIHSG
WYNTPNWLEFPLCLGTHNYLERMIRSLSQDLQKSSGYYLLLSHENDKVRRFSLEFAKRLL
NIFPLSNHLKMGMTNLNVDPKYSILHNQNDSCEVMQFLDNLVDKNSRKESNMPERFENWS
RTILKNSRDRIVIIAIIDHIASLYSQKTFDLLKSKGHYVVTIGLKNDWHSLLPTTTIGFD
QRRNLYLFKEDELETINAGLTSVRTKNKLQHSMEVTTSKPITGKELISTETESITTSTTE
ISTSETLANSDTTDSNNNSEITEIETADEEEKNPETSTESEKKPPASDDIYRRIYMDRSK
HKNPESKPQESLDNVEENTSSGDLEE
Download sequence
Identical sequences K7IP83
gi|156538639|ref|XP_001607668.1| 7425.XP_001607668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]