SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156541746|ref|XP_001602616.1| from Nasonia vitripennis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|156541746|ref|XP_001602616.1|
Domain Number - Region: 1-33
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0147
Family Psq domain 0.032
Further Details:      
 
Domain Number - Region: 222-315
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0696
Family Nuclear receptor ligand-binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156541746|ref|XP_001602616.1|
Sequence length 385
Comment PREDICTED: similar to ENSANGP00000028549 [Nasonia vitripennis]
Sequence
MELAVQKVLKGRSCKSVASDFGVPRTTLLKKCKLRNHDHPIKVVGFKRVFDDEQEIALKN
EIENMEKCMMGLTSYDVRKLAFDFAEKLRIPHNFNRTEGLAGKDWVHNFLKRHDLSFRKA
EHTSAARAHGFNQEAVKEFYTLLKKLLDEQNFAPEKIFNVDETSVSVVPKSSPKVIARRG
RRQVGGLTAAERGETVTAEVCMSAAGMFMPLLLIFPRVKVNQEFLNDAPPGAWAEFHKTG
YMQTEIFARWFKKFIEFSHAKPEDPVLLLLDGHASHVKNLEIIEMAKEHGVKILCFPPHC
THKMQPLDVGFMGPLSITFGKKVSALQRQRMQMTMRNIFSVFGKAFLEAAKMDTAVNSFK
RCGIVPFNPNIFKESDFVTAKKISI
Download sequence
Identical sequences K7J917
gi|156541746|ref|XP_001602616.1| 7425.XP_001602616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]