SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156545912|ref|XP_001606899.1| from Nasonia vitripennis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156545912|ref|XP_001606899.1|
Domain Number 1 Region: 37-51,134-378
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.37e-31
Family Nuclear receptor ligand-binding domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156545912|ref|XP_001606899.1|
Sequence length 395
Comment PREDICTED: similar to orphan nuclear receptor Tll [Nasonia vitripennis]
Sequence
MGHISHSPVEKMEAHPMTQPQPPSSSELAKCIEAGMNRDAVQHERGPRNSTLRRQMALYY
TNKESEILTSSLTNGLANGLASGIVGNIATSLSNSIVNQHGNGYTPPPQLNTALDLVLPK
SASTGPSRVSVSHRHLHHSLYSSAHPSKVTDISSPYLHHPRHHHHQHSPPPQILHPLPTI
RLPLFIMETMCEQAANIFLLNIAWAREVNSITGICLEDQLTLVENSWRDLFVLSAAQYAP
TMDPTSLIPPGPNSLAMSIEVSRFREVLMSLHTMALDSQEYACIRSVVLYKAGLENSEIV
PSSRSSDGSMSPGCSKLRDVHSIMKMKDAAQAALCTKVDVSNAVGAVKYSKIVLLIPMLK
HISAHSIEELFFRKTIGDGTRSFIADLQRFDSERL
Download sequence
Identical sequences K7IU20
gi|156545912|ref|XP_001606899.1| 7425.XP_001606899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]