SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156547613|ref|XP_001603526.1| from Nasonia vitripennis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156547613|ref|XP_001603526.1|
Domain Number 1 Region: 476-503,568-811
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-58
Family Nuclear receptor ligand-binding domain 0.0000509
Further Details:      
 
Domain Number 2 Region: 424-509
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.83e-26
Family Nuclear receptor 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156547613|ref|XP_001603526.1|
Sequence length 814
Comment PREDICTED: similar to nuclear hormone receptor ftz-f1 beta [Nasonia vitripennis]
Sequence
MSDQGGSGTAAATAEPGPAWWPPAQPWKSAAGSQPNSRTPEPGKNVSVTTINVPPPIHDM
HDGKSVCKYLGGQNGVTVSVVSSCGANSSGNGSIINTTSNNSGSGESASVDDVDGDSDGE
VSRIDFRGVNLRTKKKRDGAPGSLNNSEDTCGANDSVHQQPERPMSWEGELSDQEMSSNT
ITNQDHEETSMEGVQVCSSSPGPQEQKFPIKPEPDFRSSPGPMQSLGNNSLNETIVAVSH
VQQLHHGHHHHPHHQQQAHQQQQQAQQQQQQNLEQNQQSDLPLLVGKLLGGCNSSTPNHS
PVLIPRHHLTKHSHTRSQVPSPDSAIHSAYSVFSSPTQSPHAGRHLSHSLSRNNSDASSS
CYSYGSLSPPTHSPVQQRHAHHQQLQHAGLGGAADAGDAHLDDQDDCRIASAPSGISTRQ
QLINSPCPICGDKISGFHYGIFSCESCKGFFKRTVQNRKNYVCLRGAGCPVTVATRKKCP
ACRFDKCLNMGMKLEAIREDRTRGGRSTYQCTYTLPANLMGGNGSAQAGMGPDKMGQGQG
PCSPAPPGSEHHHSMKHHSNHSHKMQVVPQLLQDIMDVEHLWHYNDNDRVGASQAMGSLN
LSAAGSNNTANGNPTQHPDFLSNLCNIADHRLYKIVKWCKSLPLFKNISIDDQICLLINS
WCELLLFSCCFRSMSTPGEIRVSLGKSITLEQARQLGLATCIERMLAFTNNLRRLRVDQY
EYVAMKVIVLLTSDTSELKEPEKVRASQEKALQALQQYTIARYPEMPAKFGELLLRIPDL
QRTCQAGKELLSAKRAEGEGCSFNLLMELLRGDH
Download sequence
Identical sequences K7IWC6
7425.XP_001603526 gi|156547613|ref|XP_001603526.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]