SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156537343|ref|XP_001606408.1| from Nasonia vitripennis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156537343|ref|XP_001606408.1|
Domain Number 1 Region: 352-653
Classification Level Classification E-value
Superfamily Kelch motif 1.57e-42
Family Kelch motif 0.0017
Further Details:      
 
Domain Number 2 Region: 124-237
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-19
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 3 Region: 924-973
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000138
Family Laminin-type module 0.041
Further Details:      
 
Weak hits

Sequence:  gi|156537343|ref|XP_001606408.1|
Domain Number - Region: 245-271
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000343
Family Integrin beta EGF-like domains 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156537343|ref|XP_001606408.1|
Sequence length 1305
Comment PREDICTED: similar to attractin [Nasonia vitripennis]
Sequence
MAEAAQMFLFLYKCKYRRKVRAGVVAPAGEPAEDGEEKAGRRLRSRHAGGAGQLLWSLVV
WTTLLQCVAPLETAAASSQNSIVGANASACDLDSCLNGNCVNGSCLCREGWQGPNCQYCA
SKVRLSEPSGSIHDGVGNYTTDVKCSWLIESTVNSSIRMHIEEFATECGWDHLYIFDGDS
VEAPLLGVFTGLMHKDDYHIRRVPEVIARSGSALLHFYSDVAYNMSGFNITYKINACPSR
DSQVDCSDHGVCIEGVCTCDATWMGEACDVPVCPNNCSAHRGQGECNHEWHRCDCSPGFK
GADCNQTSEQGYWDAVNYNDLSPEGSASHCAVVWQDSLYVIGGESFHRAKMIYIYDFNGN
VWETPHITGVKPLPRYGHSCVLFGDKIYMYGGVIDNSTVTNEIWAFDVSAKLWENVTVHD
NCVNKTMCGPLKVAGHTANLVQSHDKKEKMVVIFGHSPQYGYLNTVQEYYFGAREWQIVE
TFGFPVKGGYGHSAAHDPHTNLIYVYGGYVSENPGTQVLTNRLYSYHPNRPREWRLLTAA
PSARFFHTAVFVSGSLMLVFGGNTHNDTIHSYGARCYSADMVAYDVTCDSWRQYTMPREM
ADLSRYGHSATVFSKSMYIYGGFDGQMLSDMLRYTPGTCEHLRNYSQCLNSRIGLKCVWD
KKASVCLPITKIAKTVLINDDPHDGRYMRCLYDTLPRGMTSHKELCKLLTDCVACVQTSY
NCVWCGKNCAHEVCRNVANAPQTRAINSLDMCDAHTGIECYQLHSCQACSSNPNCIWSWS
NGPDRCKPLANNTIQPQRSPVDICRSPCVEYTSCRNCTEAECIWCQNEERCVDKNAYPAS
FPYGQCREWTTASEKCRNTKSGNEWCSSHNSCATCRADPACGWCDDGSNTGRGKCLPGGA
RQPSHRSPESCPLDRWYFTECPICQCNGHSTCHPNSSECIQPCGNLTYGPHCEKCRPGFY
GNPLNGATCQPCSCNDQGTNCTGETGKCFCTTKGIIGDHCERCDISGLYHGDPTNKGSCF
YDLAIDYQFTFNLSKKEDRHYRAINFKNSPPKPDVDADFSITCSVIARMNITIKKANSPE
KPLLLGANCTNLTYKHRFSKADYNFGNEDNNTLTTFYVYVYDFQPPLWIQISFSQYSKLN
LQQFFITFSTCFLALLLVAAILWKIKQKYDMYRRRQRLFVEMEQMASRAFSQVLVEIERR
NSSITETDGSDTEMNNSRKKKKKKDAPSPIALEPCCGNRAAVLSLLVRLPTGGEPYTPAG
QSAGLAVASALVTLGSPRRPSQELTIKEPKKSRKSSSQHPESTCI
Download sequence
Identical sequences K7IMA1
7425.XP_001606408 gi|156537343|ref|XP_001606408.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]