SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156537351|ref|XP_001606458.1| from Nasonia vitripennis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156537351|ref|XP_001606458.1|
Domain Number 1 Region: 582-779
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.72e-46
Family Nuclear receptor ligand-binding domain 0.0003
Further Details:      
 
Domain Number 2 Region: 11-97
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.4e-26
Family Nuclear receptor 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156537351|ref|XP_001606458.1|
Sequence length 782
Comment PREDICTED: similar to ENSANGP00000012911 [Nasonia vitripennis]
Sequence
MEDEHAVREANKICGVCGDRALGYNFNAVSCESCKAFFRRNALKNKDFRCPFSENCSITP
VTRRFCQKCRLDKCFSIGMRKEYIMSEEDKVLKRQKIEQNRAKKRPGSDTRKGTKLKRES
IDDSNFDDNSTSIPSVASVASVMSESYFWESDKKYTDLDANKQPTVDSMSPVTAASVPSP
SSPPENCDIAGSKTLEMLKDSSHTSVPNFVKYSQPSSYNSSDSNVEKDQSSRVNECITAN
SNNNNFEPEKEQQVQPTKCNANIATLKKLDKKYPESIGSPNSPKCSRFESNLPNYSTFKQ
SAAEQSPYMPYAECSTSAKSVEFCTNQVASIVPQSNMEEAIMCQKSKEPSSKGSNLASKV
MQDPGLLAKLVSNPSIVAKIIQDQNIIAKFITDPEIMGKLASDPQISQFIEEKLGSSGVH
EGSEIISHEKGTTGDLDNNGISNNIIKNILEAGPSQVENPILTNLINNRCTTEEHQDQNS
DNNIPNEWNNTSEDVTKDVLQDVQRIPIAANSIESILCEAIKLEFSAYSTLGGNQNSREL
NDAERAKLNELIVANKALLAPLDDDITNLVGEECRFKGNSGLSDPMLLDVINLTAIAIRR
LIKMSKKINAFKNMCQEDQLALLKGGCTEMMILRSAINYDPDKDIWKIPHSQDRMSKIKV
DVLKEAKGNLYAEHSRFVRTFDPRWRDENIILILSAIALFSPDRPRVVHSDVIKLEQNSY
YYLLRRYLESIYPGCEAKSTFLKLIQKISELHRLNDEVVGVYLNVNPSSVEPLLIEIFDL
KH
Download sequence
Identical sequences K7IMA5
gi|156537351|ref|XP_001606458.1| XP_001606458.1.61660 7425.XP_001606458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]