SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156538248|ref|XP_001602490.1| from Nasonia vitripennis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156538248|ref|XP_001602490.1|
Domain Number 1 Region: 149-283
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.83e-22
Family Toll/Interleukin receptor TIR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 9-103
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000207
Family DEATH domain, DD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156538248|ref|XP_001602490.1|
Sequence length 417
Comment PREDICTED: similar to myd88 [Nasonia vitripennis]
Sequence
MPDLSLVPLTALSPEVQHLISTFLNPPKVIPAGCGTSGLPRDWRGLAQVCSIGGELMPAI
ASHADPTKRILDIVQTKSQNFTLKSLQDALKSLERWDILEDSEPLLERDALLYMERLKKS
QETAEGNDYSADAEILTFDDQFRIERGEGKQHYDAFLLYANEDEEFAQEMIENLEKKNHL
KLCLKERDLVPGLSFEHEAIMRLISERCNRLITIISPDFFKSPANKFFLNYAQASGIDKR
QERKIIPCVYKNCELPPQLTYYSKIYYKQVSPDFFWDKLTRSMKAIQSVQNAQMFTKNSS
DSKAKSSNSTKNTPLQEPKKKVEKNPPVETSKAVNGLKNRVLLPWKRRENAELSEKPNKK
GEKLVTQDPIPKLPSLDGLDSLSCVTSSANTTTKKSKKNKKFLGNYVKKVQSLLTKS
Download sequence
Identical sequences K7INK1
7425.XP_001602490 XP_008206894.1.61660 gi|156538248|ref|XP_001602490.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]