SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156541142|ref|XP_001601489.1| from Nasonia vitripennis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156541142|ref|XP_001601489.1|
Domain Number 1 Region: 256-497
Classification Level Classification E-value
Superfamily vWA-like 7.66e-78
Family Integrin A (or I) domain 0.000000758
Further Details:      
 
Domain Number 2 Region: 481-585
Classification Level Classification E-value
Superfamily Integrin domains 1.1e-20
Family Integrin domains 0.00098
Further Details:      
 
Domain Number 3 Region: 763-847
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000000693
Family Integrin beta tail domain 0.0027
Further Details:      
 
Domain Number 4 Region: 118-164
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000837
Family Plexin repeat 0.0044
Further Details:      
 
Domain Number 5 Region: 676-714
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000138
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Weak hits

Sequence:  gi|156541142|ref|XP_001601489.1|
Domain Number - Region: 724-761
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00391
Family Integrin beta EGF-like domains 0.017
Further Details:      
 
Domain Number - Region: 596-623
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0558
Family Integrin beta EGF-like domains 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156541142|ref|XP_001601489.1|
Sequence length 928
Comment PREDICTED: similar to integrin beta subunit [Nasonia vitripennis]
Sequence
MRDVLRVIDLLAFGILKVRASMYGVMVPQVRNSQRTDAAELLMLLVMVVAGFEVICDKGE
KTFPISDEQDSALLSGFYQSFGKYLRKKMVGSSRWGLILLLLTWISSSAAQYSKPTGANP
CIGKQSCHDCIQTPTCAWCSRPNFEYNRCFSPYLSKKIDEACPDAFNPDNVYIKRRAKEI
WKGNYTVGTAIEEHIEVSAGGSHSSSGSFNINSSSGTKTSSVIGGKNEAVQLYPQHIELK
LRINEAQKIKIQYAQAEDYPVDLYYLMDLSNSMKDDKQKLSDLGQLLVESMKNITSNFAL
GFGSFVDKVAMPYVSMSGDNLKSPCDGCAAPYGYRNHMPLSRKPKEFAEQVRNASVSGNL
DAPEGGFDAIMQAIVCRDEINWRERARKLLLFSTDAGFHFAGDGKLGGIVKPNDGCCHLD
HNGLYTHSTLQDYPSISQINLKVKENSVNIIWAVTEEQLKIYQSLTNHIEGSYAAMLSED
SSNIVDLVREQYNAISSTVELKDTASNWVNINYYSNCLGGGEMVETNKCEGVKVGNKIEF
TAEIIIPACPKDRSEWKQKFLIYPVGINESLTVDLEMICDCGCENPDSPSYIPNAFECNY
NGDLSCGICICKPGFFGKKCECGVNDKVQTVKNEFVCRPDNTSTVDCSGRGICECNQCNC
YPRENPDEIVDGEFCECDNFSCDRRNKTLCSGHGKCNCGHCECNPNWTGPACDCNTDKTP
CIKFGLECSGHGTCECGKCKCHAEGETIYKGTHCQICTNCPNRCEELKPCVLCTVFKAGN
LTEAECNSTCDEYDIQIVETLEINADEDETGCWGYDEQDCKYYFGYLFNMTTHKLQVKVQ
EARECPPQVYVLGIVLGVIAAVVLVGLALLLVWKVATSIHDRREFARFEKERMMARWDAS
ENPIYRQATSTFKNPTYTASGAHMSMHK
Download sequence
Identical sequences K7JAF4
gi|156541142|ref|XP_001601489.1| 7425.XP_001601489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]