SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156542983|ref|XP_001602885.1| from Nasonia vitripennis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156542983|ref|XP_001602885.1|
Domain Number 1 Region: 343-577
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.77e-67
Family Nuclear receptor ligand-binding domain 0.000000191
Further Details:      
 
Domain Number 2 Region: 196-278
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.89e-29
Family Nuclear receptor 0.0000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156542983|ref|XP_001602885.1|
Sequence length 579
Comment PREDICTED: similar to ecdysteroid receptor A [Nasonia vitripennis]
Sequence
MDTSQQQQQQDPALGLVKAEAPEQSPASSVGSSSGNGNRPPPAGNGSGLFAGIASSNKRP
RTDDWLAPESPQGPLQPQQQQQQQQQQQQHIYLSPQQQQQQQQQQQSMHQQPPMAHSTPI
TQQQQQQQQQQSVIGSQPPSNNGYASPMSSGSYDPYSPNGKIGRDDLSPPSSLNGYSADS
CDAKKKKGPTPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNC
EIDMYMRRKCQECRLKKCLHVGMRPECVVPEFQCAVKRKEKKAQKEKDKPNSTTMNGGSP
GGIGPAEQMGVKMEPAEVDYSMSGNSGTVASIGSLNGLNYVSPEQEELINRLVYFQDEYE
QPNEEDVRRITVSNQSTENEDPSDVRFRHITEITILTVQLIVEFAKRLPGFDELRHEDKI
VLLKACSSEVMILRMARKYDYQTDSIIFANNQPYSRDSYTLAGIGNIIDDLLHFGRLMYS
MKVNNAEYALLTAIVMFSERPNVSEGWKVEKIQEIYLDALKAYVESRRKPKASAMFAKLL
SVLTELRTLGNQNSETCSNLKLKKKKLPPLLAEIWDVAS
Download sequence
Identical sequences K7IPV5
gi|156542983|ref|XP_001602885.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]