SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156543074|ref|XP_001604993.1| from Nasonia vitripennis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156543074|ref|XP_001604993.1|
Domain Number 1 Region: 3-86
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00000000000262
Family Hormone receptor domain 0.0031
Further Details:      
 
Domain Number 2 Region: 81-162,196-415
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000165
Family Rhodopsin-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156543074|ref|XP_001604993.1|
Sequence length 417
Comment PREDICTED: similar to parathyroid hormone receptor 1 [Nasonia vitripennis]
Sequence
MNESYQCDELIRDFEKSSDRCEPLWDTKLCWPSAAVNETLELPCPRREFDNQTASRDCIL
FDDGSGTDRSIWTMGNYSYCQDPDNYTGLFIAVAHEKYLQTEDQMWEHKLLVTSQLIYLL
SFLVLAVALVLFLLFKKLRNARTRLHMHMLSATIMQVVMWLMHSVLFDTQLLSAYMYLEV
LSKINVHVAFKFSNDFRLIVEQMFTRLNSYLHYIVLAGLERYFETTSLFWLLMEGWFLYE
LICRKPLETKTSIKRYVIIGWGVPIIVTSPWMVYHVYSAHNDVYWVKHDLTVYLIAVSAF
LTFVINLYFFVEISKVLYAKMKVSVQLQQQQQKKKMEYKTWVRSTFMLVFLFGAQNALYV
AWFFVDRTKPKLLFLLIIKVFASFQSNKPRLQGIFVAFIYCFLNREVRAVLRKNLFG
Download sequence
Identical sequences K7IQ08
7425.XP_001604993 gi|156543074|ref|XP_001604993.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]