SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156543256|ref|XP_001606711.1| from Nasonia vitripennis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156543256|ref|XP_001606711.1|
Domain Number 1 Region: 17-124
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.57e-22
Family Hormone receptor domain 0.00065
Further Details:      
 
Domain Number 2 Region: 89-389
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000595
Family Rhodopsin-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156543256|ref|XP_001606711.1|
Sequence length 422
Comment PREDICTED: similar to putative diuretic hormone receptor II [Nasonia vitripennis]
Sequence
MSNATLGNLRLGEPEPDCQLLMSIYESKNQRKEDELVGKSCPVGWDTLLCWPKTKAGSMA
VQPCFDEFNGIRYDVKQNATRWCWPNGTWNGYTNYTQCRELYVPELPVDSSGVEITTNLY
LIGYGLSLSTLIIAVIIYLYYRELRCVRNIIHTNLMFTYILANFLWILMIVSQVSLEKNI
PICIIFYSMYHYFQLTNYFWMFVEGLYLYVLVVKTFSGDIVKLKTCLFIGWGIPLIVVLV
WGIIKALAENSAAAGSPVRALSNHCPWMIPHPYDWLYQVPAILVLCVNVIFLFMIMWVLI
TKLRSANTPETQQYRKAAKALLVLIPLLGVTYILMIAGPTEGQVANLFAYSRAVLLSSQG
LLVALFYCFLNSEVRNALRHHYQRWSTERSLGHHPRYYAQYTPRSRTESIRLTLKEHKIL
ES
Download sequence
Identical sequences K7IQB3
7425.XP_001606711 gi|156543256|ref|XP_001606711.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]