SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156544686|ref|XP_001605321.1| from Nasonia vitripennis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156544686|ref|XP_001605321.1|
Domain Number 1 Region: 7-144
Classification Level Classification E-value
Superfamily Cap-Gly domain 2.49e-33
Family Cap-Gly domain 0.001
Further Details:      
 
Domain Number 2 Region: 124-373
Classification Level Classification E-value
Superfamily L domain-like 6.12e-26
Family Ngr ectodomain-like 0.044
Further Details:      
 
Domain Number 3 Region: 438-525
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000537
Family Ubiquitin-related 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156544686|ref|XP_001605321.1|
Sequence length 525
Comment PREDICTED: similar to tubulin folding cofactor E [Nasonia vitripennis]
Sequence
MVEDRNCIGCRVDCEGHIGTVKYVGTVGNTKGQWLGIDWDDPSRGKHNGTYEGLKYFETW
HPTSGSFIRPGKANFGISCPEAIKVRYGYIDDELAGIDRDSIASVQKSINAPFVEMVGFS
KVNKKQSKFDQLKIVCMQAQCISSAGYPGELAALCSMIEELDLSHNLINSWKVVAEICTE
LQILQQLNVSDNHLPVENGMEIYAHAFPVLRHLTMGRMKYDWPAVMQCLKAFPSIQELIV
SYNNIETISGVEESLNIMKLTELSLEHNLISNWNEVLKLGILPCLKGLNLNSNKIEDIRF
PTTEPTDKSHLFPNLTQLHISNNNIRDWRSISELEKLHRLQDLKFRENPVLKEQNVQTGI
QLVIARISALQYFNGTEIIPSERRGAEYDYLKLFASGWRSSEQDILKRKEFITNHPRFPA
LVEKYGVPDTSESTKSTQLSSNVITVEFVCPDNPNIKSIKKKLLKNMDVQKLMGIVQRLF
RINGKIPTLSFVRPNVSEDEIPLDKPLQELSYYLIDEGDLILVRW
Download sequence
Identical sequences K7IS98
7425.XP_001605321 gi|156544686|ref|XP_001605321.1| XP_001605321.1.61660 XP_008213470.1.61660 XP_008213471.1.61660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]