SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156545643|ref|XP_001603852.1| from Nasonia vitripennis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156545643|ref|XP_001603852.1|
Domain Number 1 Region: 429-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-16
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 34-86
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000585
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 3 Region: 170-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000513
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 4 Region: 346-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000942
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 5 Region: 478-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000148
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 6 Region: 400-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000163
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 7 Region: 286-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000175
Family Classic zinc finger, C2H2 0.054
Further Details:      
 
Weak hits

Sequence:  gi|156545643|ref|XP_001603852.1|
Domain Number - Region: 250-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000299
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number - Region: 519-551
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00108
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Domain Number - Region: 984-1007
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0183
Family Classic zinc finger, C2H2 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156545643|ref|XP_001603852.1|
Sequence length 1008
Comment PREDICTED: similar to zinc finger protein [Nasonia vitripennis]
Sequence
MEVPETKVSHDNLLEYDDMEIPLPIDQDSYTNTRPYPCDFCSKRFRKKANLMNHMVTHQT
ERPHGCNLCGARYVRKSDLMNHLKIHAYAPTRDGLEDDLEDPLATEEEENHPVKGRKKKV
QTNVPRKRKAPPGAKRTTLDVGAKLDISKWTGQMTSEQQVPRWPVTDATKPYVCQFCGVG
FAREKALASHSRIHGGDSPFECTSCGEMFWDVNTLQEHMRVKHGLGIVQPEHEEIENESN
YAGDERFGEFFCETCGVPFHRLDLLKRHKKIHIKQEVDPMDGESSSQHHVCNVCGEWFEE
ALALLAHAESHARSPSRRCLLCGERCRDDAELAEHVREMHAEDAPPNTCVMCGKTCKDKR
SLLKHSWIHNTDKTFGCTKCGKRFHSKARLRRHMVSHRNKMVACDECGEEFPDGRALVSH
RHSHNKDLGGRTFPCRECGKTFGSRSSQQIHIRIHTGERPYGCRFCWKAFADGGTLRKHE
RIHTGEKPYGCAICPRAFNQRVVLREHVRAHHSGPDPKCHNSLTPYMCKVCGDTLPTSDE
LVAHIVAHCDENTALRRQPQSGPRKYKRRRKLKQDGTAFGGRVSESLDNIDAPSDSDENT
KRKLGKKSKQHRANVEEGYQNVLKSFESSLQNINSIVSNSKTHPAKTKTPKKKPKKEDKK
GGVATSSGADTPTANHPGRPKMIHTQKTRVPVEMGTDGVKKGQKTKTMVTRTPKVMPNEQ
QTLTSPQMHHKVPGVFPGGERNRPRTKNVSYHVEGRQQFIPATFAKPRDEETEAASGIAP
AIEMVNIKIEPDLPKVAPNQNHTINNNGDIVEFKQEKLDKPEKPTPKKRGPIKRTKRRQA
AATRRSKDKLAIPVAEVPNNNNIEVPEPMMQHVEMSQQEETPTAQEHQVQPTQLFESVVD
GNNLEVAFEANVISEQEEMVQESILPDLDKVNHVDDLGSSSSGVGNVKLSVKVESAPDGM
LDVHSLMGSVEESVPETIIPDTVEYTCEMCAAVFETRAELLVHVPIHI
Download sequence
Identical sequences K7ITM0
7425.XP_001603852 gi|156545643|ref|XP_001603852.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]