SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156549971|ref|XP_001603666.1| from Nasonia vitripennis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156549971|ref|XP_001603666.1|
Domain Number 1 Region: 575-586,644-772,800-904
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.72e-38
Family Nuclear receptor ligand-binding domain 0.00041
Further Details:      
 
Domain Number 2 Region: 502-584
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.69e-29
Family Nuclear receptor 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156549971|ref|XP_001603666.1|
Sequence length 916
Comment PREDICTED: similar to thr4 [Nasonia vitripennis]
Sequence
MTLTSSPCELDNMSLFQDLKLKRRKVDSRCSSDGESVADTSTSSPDANMPGSPGCPIVKV
KSEYLRGSPSPGTRESCLQRGGGAGGGGGPQANQQQQQVTAKLQEALTERASPDSVFPDL
ASPRLAGQGMANQQQQQQRSCTPAPTRSSPHSPGQAVSSTPSTPMPQESAVTSRSSVTPD
RGGNNLTSTQSKEESDNSVFDGGGGTTTTSSTTNGSNSSNANGRPESNNCAQSVVHRSSP
SSQYSNASPSPNHQQQQQQQQTSPRPRPPSVPPHLLSHHQFWSQAPNVQGFATQRLLNGV
ISGAVASYVTGNNGATGNVNLNVTGNNGTSAGSNVTGLNTTSGEGMKPPAQRAAPAPPRP
PPNVIMSEVGGVRTMIWSSPAMDPVPPPAASWTSTASCSSSEESAAQLLLNLGQESRGSK
PTGGTGGGGSSYSSGPPLNMERLWAGDLTQLPAAQQMQALNLTASGSQQQPWVRNGSLVK
SEVAAQSGNAASQQDHEEDETPMICMICEDKATGLHYGIITCEGCKGFFKRTVQNRRIYT
CVAEGSCEITKAQRNRCQYCRFKKCMDQGMVLQAVREDRMPGGRNSGAVYNLYKVKYKKH
KKTNKSNATSNMGVMGDVVNSQSTPSHPTHSGHLVNGTILKTALTNPSEVVHLRQRLDNA
LVSSSRDHMPLETTLAMIQTLIDCDEFQDIATLRNLDELLDHKSDLLSDKLCQIGDSIVY
KLVQWTKRLPFYLELPVAVHTQMLTHKWHELLVLTTSAYQAMYGQHKVSSSGNDVTGANF
NQEVSNNMYTLQACLTSMMGRPITMDQLRQDVGPMVEKITYVTLMFRRVKLRMEEYVCLK
VITMLSQARSDTVNLEHIQERYMCCLRSFVEHSAPSQPSRFHDLLVRLPEVQSAAALLLE
SKMFYVPFLLNSTIQR
Download sequence
Identical sequences K7IZP9
7425.XP_001603666 gi|156549971|ref|XP_001603666.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]