SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156550219|ref|XP_001601649.1| from Nasonia vitripennis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156550219|ref|XP_001601649.1|
Domain Number 1 Region: 11-86
Classification Level Classification E-value
Superfamily Hormone receptor domain 2.88e-23
Family Hormone receptor domain 0.001
Further Details:      
 
Domain Number 2 Region: 74-365
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000119
Family Rhodopsin-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156550219|ref|XP_001601649.1|
Sequence length 391
Comment PREDICTED: similar to GA17177-PA [Nasonia vitripennis]
Sequence
MALRIIDSWSVAATEPYCPAIFDGWSCWPNTPAGTTAYAPCPAFITGFDPTLKAHKECEP
NGTWFMHPVTHKIWSNYTTCVNLVDLSWQQQLNVLYETGYTISLVALLVSLGILTYFRSL
RCARITLHMNLFASFAANNALWLIWYGSVVANAQLLLNNGFMCRFLHVILHYFLLTNYAW
MLCEGFYLHTLLVSAFTSEHKLVKWLMALGWPIPAIIVTIYTVLRATSDDNADTLQCWIN
EGNYMVVLIYPVCVSTLLNLLFLCNIVRVLLTKLRAGPAIGSQPSRSMLQAFRATLLLVP
LLGLHYLVIPFRPEKGHPWEYAYGVMSAITASFQGLCVAILFCFCNGEVIAQFKRKWEGT
AFARKRANSCTATTVSFVRSTAGPMAGEEKV
Download sequence
Identical sequences K7J018
7425.XP_001601649 gi|156550219|ref|XP_001601649.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]