SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156551519|ref|XP_001605516.1| from Nasonia vitripennis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156551519|ref|XP_001605516.1|
Domain Number 1 Region: 61-231
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 8.52e-22
Family Phospholipase D 0.065
Further Details:      
 
Domain Number 2 Region: 317-369,417-486
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0000583
Family Polyphosphate kinase C-terminal domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156551519|ref|XP_001605516.1|
Sequence length 512
Comment PREDICTED: similar to ENSANGP00000021095 [Nasonia vitripennis]
Sequence
MSSLSICVKSLRRFPRTKLRRQKVLTCIVRCKMHAAMLDDEKITDFEAVQVESSSLAWLH
KAAPAFPVDGSKVTIIHEPSEFYSTLLEKCKTAKTRITLASLYLGTGKLETELVKTIKQT
VESNNGNVEVNILLDYMRGSRGKMNSKEILRPLLEGKYGHCCRVFLYHTPRLRGFLKALI
PDRFNELIGLQHMKLYLFDDTLIISGANLSNDYFKNRQDRYFMLEDCKELCDFYCSLVEK
VSEFSFQLESDGSTRFSDKISSHPFESPDEEFTEEASDRIRNLFQAEINKRSELYKAEIP
RTDTWVFPLVQMGQLNIRHDSEITRRILERAPTGATLRLATGYFNLTTEFRTAILNSCRA
DCHLLTAHPEANGFFDAKGIAGGIPAAYTKIEESFFKMCEKMSQSDRIQLWEFAKPGWTY
HAKGLWYSMPNEQKPSFTLIGSPNFGYRSVERDLETQIAVMTRNEKLQESLKKEYERLFD
SAKPVTQRTFSQRDRVPPAWVRMVVLFFRYYF
Download sequence
Identical sequences K7J1X4
gi|156551519|ref|XP_001605516.1| 7425.XP_001605516 XP_001605516.1.61660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]