SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156552325|ref|XP_001601409.1| from Nasonia vitripennis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156552325|ref|XP_001601409.1|
Domain Number 1 Region: 27-511
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.57e-75
Family Integrin alpha N-terminal domain 0.000000534
Further Details:      
 
Domain Number 2 Region: 671-807
Classification Level Classification E-value
Superfamily Integrin domains 1.05e-31
Family Integrin domains 0.0014
Further Details:      
 
Domain Number 3 Region: 813-1066
Classification Level Classification E-value
Superfamily Integrin domains 3.14e-30
Family Integrin domains 0.0015
Further Details:      
 
Domain Number 4 Region: 511-668
Classification Level Classification E-value
Superfamily Integrin domains 1.54e-22
Family Integrin domains 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156552325|ref|XP_001601409.1|
Sequence length 1106
Comment PREDICTED: similar to ENSANGP00000004747 [Nasonia vitripennis]
Sequence
MWNHGVVVASLLFLALLLCNENHVLSFNVETVHYAKYENVVTKGSMFGYAVAGYRDSTGR
GHVIVGAPMAPSTNAPPSRTNHSDIGKGGAVFYCDIAQDNACSYVVFDYNRGHNFIMSKQ
IHDTQQIDNKTLQWLGATLSASETDGGPLLACAPRYRWFGYNKANQSVGDHKDVLGSCWL
AHKPTEEFNSASRTAQPNLEFSPCRNSEFSGHHRQGMCQAGIGAAITKDGNRLFIGAPGS
WYWQGQLFTAPSNVKLPFVPSKEIINGKESSSSYERLGLLSTKEGPAWEDNNYLGYSVAV
GAFRGDEDSGVAVGVPRGADLHGKVLLFTSTLFNHQNITGEQMGAYFGYALAVNDIDGDD
KDDLIVTAPFFTQPELAGIKIETGRIYVFYQGGGTTPFQKFDFRNGDSNRGQFGLSVSSL
GDIDRDGYGDFVVGEPYGGPANRGAVYIYHGSKDGVEEKYSQVIYSENMDPVMHTFGWSV
SGGRDLDGNGYPDLIVGAYESDAAVFFRSRPVIEVFSEINFDTESVDLDAKICLFNESIA
TVCPLLKVCCFYSGNSVSRQYTFKISITLDDKKKMDPRILFHDSTSVKNITITLTKDEFW
CNQYSVYVMKDLKDKLTPLDAEMHIELLNDERNTKVPPTRIANKGLRAVLGPKNIKKRDS
LRIQKNCKDADVCIPDLTIHVVKSVERYLMGSTEELVLHVSIYNSAEDAFESRFYMPLPP
GVEYSKLEFPAETSDKNVDCKQPDESNNNTLICDLGNPLSKGRIVKFSVRLRPTMFHGMK
PQFELNMSVNSTNPEHSTTTNDNYFNVALPIWIENDLLIEGQSKPHEVDLNSADYANVDI
EKLMTDPSSGPVVTHNYTIRNNGPSPVLKLNTTLVWVAETNAGEVLLHLIEQPVVSDKTK
FICPTANANYELIYKEPRKTRNAGERELEYLNEALFDDRQPMNIRYRRQVSNELPSDSKK
SLVGSGPVNENLCATALCVEWTCEVGPLERDEEVTLSAKFLINMKTLKKITTNEKLTIST
KLIGNVTAQPYIGEPIKKVFSDYEIKTVIEPLKNLNTSDMIPLWIVVLSACAGMTILLLL
AFLLYKCGFFKRNRPSAAPERQPLNR
Download sequence
Identical sequences K7J317
XP_008206653.1.61660 7425.XP_001601409 gi|156552325|ref|XP_001601409.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]