SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156552555|ref|XP_001599309.1| from Nasonia vitripennis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156552555|ref|XP_001599309.1|
Domain Number 1 Region: 9-200
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.26e-39
Family Nuclear receptor ligand-binding domain 0.0003
Further Details:      
 
Weak hits

Sequence:  gi|156552555|ref|XP_001599309.1|
Domain Number - Region: 341-428
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00187
Family RNA-dependent RNA-polymerase 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156552555|ref|XP_001599309.1|
Sequence length 463
Comment PREDICTED: similar to CG11502-PA [Nasonia vitripennis]
Sequence
MHFFSVCLKRQAVQRGRVPPSQQSHPGATGQFTLTNGDSVSCSSINGHSYLSSYISLLLR
AEPYPNSRYSQCMQPNNILGIDNICELAARLLFSAVEWAKNIPFFPDLQVTDQVALLRLV
WSELFVLNASQCSMPLHVAPLLAAAGLHASPMAADRVVAFMDHIRIFQEQVEKLKALHVD
SAEYSCLKAIVLFTTGKLLEITYKIEAGAINRNKKREYQKNLIRRIETNSKENNPREMYR
GINAIRKCFRSRAQLMKDENGDLVRNDNELLSLWKNYFDKLLNVHENSEELGDEIHTAEL
HVEEPSYQKVEAAIKKLKNNKPAGKYSIPAELLKYGGVELTLLLGVPKKLVRLIQICLNG
STGKVRVGGNVSEPFTIRDGLKQGDGLSTVLFNLTLEYVVRKMQVSQLGATLNGTTQILG
YADDLDILGDCRETVARNVEILMKAADTSSLFTDRLSATPYKR
Download sequence
Identical sequences K7JBL6
7425.XP_001599309 gi|156552555|ref|XP_001599309.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]