SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156553276|ref|XP_001599756.1| from Nasonia vitripennis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156553276|ref|XP_001599756.1|
Domain Number 1 Region: 386-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.85e-16
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 2 Region: 358-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000747
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 3 Region: 428-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000453
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 4 Region: 326-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000761
Family Classic zinc finger, C2H2 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156553276|ref|XP_001599756.1|
Sequence length 490
Comment PREDICTED: similar to escargot-encoded protein [Nasonia vitripennis]
Sequence
MLVDEMPRSFIKKNNSYSHCPLKKRPVNVVDDVSEPENLSTKPEDLSRSAPKRSRSPSPI
AVSSPVHYPVLKRSPSPICASTRSPSPVAQHPIAHIPSYQPQQHHYPTKAMTPPAAIAPV
HPVAKKARVEVLQHDNASASAAIGSPMHFMAASKSPLEPLNLNSPVEPLAHYASPAWARA
AHAAPLYPPHYLPYPAAYRYHHAAAELYPAYPVAAYPHSSPEHQSVSPSPPHAALTCQSI
QRPLARSYASHWSSPDHCGLSPTSSLGSSAMRSPPPVTPEDLSSPGSDSGRSSAGSTSAP
GSMIVKLDKSPGASSSSSSNGSSSPRYQCPDCAKSYSTYSGLSKHQQFHCAAAEGQTKKT
FTCKYCEKVYLTLGALKMHIRTHTLPCKCHLCGKAFSRPWLLQGHIRTHTGEKPFSCQHC
NRAFADRSNLRAHLQTHSDVKKYSCSSCSKTFSRMSLLTKHQEGGCPGGSRGSLNSRERD
SRKLVFEIPD
Download sequence
Identical sequences K7J8M7
gi|156553276|ref|XP_001599756.1| 7425.XP_001599756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]