SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ADAR004069-PA from Anopheles darlingi 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ADAR004069-PA
Domain Number 1 Region: 322-611
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.63e-45
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.00000191
Further Details:      
 
Domain Number 2 Region: 621-741
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.22e-22
Family Ricin B-like 0.016
Further Details:      
 
Domain Number 3 Region: 22-233
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.22e-20
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ADAR004069-PA
Sequence length 750
Comment pep:novel supercontig:AdarC1:ADMH01003950:12602:15732:1 gene:ADAR004069 transcript:ADAR004069-RA description:""
Sequence
MLMSSVLLVWIRQLLELLLNFIFPTGWLEPLLEQVARNDTTIAVPLIDRIDDHDLHVIMN
VSSHIFGGFEWDLNFGWWYRGMFPRREAIHKLPSVPFESPVMAGGLFTISRSFFARLGWY
DEQFRVYGMENSELSIKSWMCGGRILAVPCSHVAHIRKSSHPYIGQKYVNVTLVNSVRVA
EVWMDEYKRIVFDVNGVPGYSEQLFGSVRDQKAIRKRAGCKSFQYYLQRAYPEMPSPIVP
GQFRESFHPPTASNNVHQKLGSPKALYPPGDMGGAVILNKSNPSIAQAIRASMKRYGLNE
YASDLVSMHRRLPIVPDPWCQRAAAHFLPNLPPTSIVVVFYNEAWSVLVRTVHSILDHSP
PHLLQEIILVDDYSSLPHLKTQLKDYFEAYPKVRIIRAAMRMGLIKARVLGAKMATSEVL
TFLDAHVECAEDPLDLGVSTNISLLLAGAFEWDLNFGWCERKQLHKRYAHPLEPFDTPAM
AGGLFTIRRSFFERLGWYDEGFDIYGMENIELSLKTWMCGGQLLTVPCSRVGHIQKEGHP
YIQNIKRDVQLYNSIRLAEVWMDEYKRIVFDVNGVPYFSEELFGSVETRQRFRQQAGCKP
FRYYLETVFPELTIPNVFGQFRGKVKNVALGHDHCLTVVDTAKGSPHMAPCNEADSDQFW
THSYYSDINSYKMCLDFTGTRLRSIVCHRRRGNQGWMYVVETKQIWNMGHGSCLAVSTHA
NGSTLVMQKCNENSKQQQWLVTFIDYSDLY
Download sequence
Identical sequences ADAR004069-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]