SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ADAR007741-PA from Anopheles darlingi 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ADAR007741-PA
Domain Number 1 Region: 203-510
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.14e-37
Family NodB-like polysaccharide deacetylase 0.014
Further Details:      
 
Domain Number 2 Region: 119-156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000654
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 60-101
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000251
Family Tachycitin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ADAR007741-PA
Sequence length 619
Comment pep:novel supercontig:AdarC1:ADMH01003657:24080:38644:1 gene:ADAR007741 transcript:ADAR007741-RA description:""
Sequence
MVKFLALTGILALVVASATAEVRVKRQAEETTKKEESFEKELCKDKDAGEWFRLVAGEGD
NCRDVIQCTSSGLQAIRCPAGLYFDIEKQTCDWKDAVKNCKFKNKERKVKPLLITDEPLC
QDGFLACGDGNCIERGLFCNGEKDCTDGSDENSCVSKFLVATLVVAKRVDRGCNLSTTHD
IVTVHAVVAGGPADIESDPNRAPPCDPSVCVLPDCFCSEDGTTIPGDLPAKDVPMMITIT
FDDAINNNNIDLYKEIFNGKRKNPNGCDIKATYFVSHKYTNYSAVQETSRKGHEIAVHSI
THNDEERFWSNATVDDWAKEMAGMRIIIEKYANITDNSVVGVRAPYLRVGGNNQFTMMEE
QAFLYDSTITAPLSNPPLWPYTMYFRMPHRCHGNLQSCPTRSHAVWEMVMNELDRREDPT
NDEYLPGCAMVDSCSNILTGDQFYNFLNHNFDRHYDQNRAPLGLYFHAAWLKNNPEFLDA
FLYWIDEVLANHNDVYFVAMTQVIQWIQNPRTVSEVKNFEPWREKCVVDGQPACWVPHSC
KLTSKEVPGETINLQTCVRCPNNYPWVNDPTATAESRDRSFGAAGIRYRYFTGDRAGGRR
QTPAVVAAAAVVTATVRNN
Download sequence
Identical sequences ADAR007741-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]