SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ADAR008756-PA from Anopheles darlingi 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ADAR008756-PA
Domain Number 1 Region: 177-476
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.36e-39
Family NodB-like polysaccharide deacetylase 0.01
Further Details:      
 
Domain Number 2 Region: 71-115
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000146
Family Tachycitin 0.025
Further Details:      
 
Domain Number 3 Region: 130-165
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000524
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ADAR008756-PA
Sequence length 540
Comment pep:novel supercontig:AdarC1:ADMH01003045:12246:16996:1 gene:ADAR008756 transcript:ADAR008756-RA description:""
Sequence
MTKLTGMGLFLLCTLTLLITFTGNGGRWCGGSNDLEGRNIGRKRCSRGWSSPLPRASKRN
PDRPVPKMWTNTECAKYYLCLDGEVFEFKCSVGLLFDVTRQICDFKQNVENCDITAEARV
PKPLLKDAKCEERSQLGCGDGTCLPKEYFCDGSVDCADGSDEGWCDVEHDPDPVYPCDTS
ECSLPECFCSKDGTMIPGRLERYHTPQMILLTFDDAVNFENWELYTEKLFTAGRKNPNGC
PIRGTFYVSHQYTNYAQVQRLWNDGHEIAIHSITHRGPEEWWSRNATIEDWFDEMVGQAN
IINRFANVRMEKLRGMRVPFLRVGWNRQFLMMKEFGFVYDSSMVAPHSNPPLWPYTLDYK
MPHACNGVHQYCPSRSYPGVWEMVMNQLEAGEYTCGMVDTCPPHMDGEDVYRMFVHNFKR
HYHSNRAPLGLYFHSTWFRKQAYLDAFLRFLDDMAKYPDVYFVTNNQAIEWMRNPTTSNQ
LGRFEPWQCRPKQLDPQEQACNLPRTCKLHSRVLQQDRYLYTCNECPAQYPWIRNEFGLD
Download sequence
Identical sequences ADAR008756-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]