SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|154796841|gb|EDO06021.1| from Babesia bovis T2Bo

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154796841|gb|EDO06021.1|
Domain Number 1 Region: 791-1055
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-83
Family Protein kinases, catalytic subunit 0.00000931
Further Details:      
 
Domain Number 2 Region: 20-140,394-439
Classification Level Classification E-value
Superfamily EF-hand 1.42e-24
Family Calmodulin-like 0.0066
Further Details:      
 
Domain Number 3 Region: 681-781
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-23
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154796841|gb|EDO06021.1|
Sequence length 1112
Comment asparagine rich protein, putative [Babesia bovis]
Sequence
MINLNVTPKMKLGKIKKEQLRKFDRSELDILIKLYKELANRSESRGIDKQTFLQYFNLPG
LWGERLFHYFDTNGSDFVEFDEFLNGIATCCRGTRSEKINVLFHVFDLHDDGQIEKSELV
AMLSNFPIIVTHMTKFTHRKRQFWANGHGVDYLSTASDTDLQTSDHSYKQCDSTDVELHK
SLTPESTMNIKKTLRIPSSDWRELASSISKLSFQSGESTDAHSMQSEIDCIEDIGENITN
SPQNKGCANSPKGVIKYHQGISQTTSIANNASQCLINISDGYISEHGSSTCDSSDEGDDD
EPILHQHEPNNISSNYKKASDIVNIKDSYWIDELDTKSKEMEMPQFTTKLEIQKQRSRKS
KGHNEKGKRYIQGRNRAKSLAIEIIQREQMMGSDDNALEALVEQILEDVKFSANGTLDFD
SFKSWINTNPAILTAFAEYMHEEVWVLHGNAFMITPETRRLMQSDKTNKYLSQIKNGELK
DADDLTLYDSGIQTKLNRLFMAHGKRGENMASDQLWNYLCELPKNNRIKRKSTWDNVLNE
GWMNIKGENITSPISFIRRPLSCPNCKSPYFMCPKCYKTNDTLYVNFKKGIHIECTNCVK
LNPEQRLDKCWLCNWNFGDAIKLVFMNSSDARIDTETTGLGIQDPIMTKIVQNSLEHLTG
QSTSGFDTIITSNDGTWPHSVEKLVKKAGYMYKKGRRLRRWHKRYYVLIDNILYYYRSEQ
STKPRGCIFLEGYHMDPLPMRHGSHMYGFRLFHTGYTPTLRNLYLKSNEECLEWVEALSK
AMHQQSLMQLYAIGEQLGYGKFSVVYRAVHKRTGEEYAIKIVDKSKVGCLERDLLRSEIA
ILRLLRHKHVIYLKEISDMHDSLYIVMELVRGGELYDLIKQKKALSEAYTHKIITQLLQI
VAYLHKCGIVHRDIKPENILLTDKSDTATIKLTDFGLSTLCGPNQLLTQPCGTLAYVAPE
VLTMEGYNQKVDVWSIGVIMYLLLSGRLPFSVRKPITTDINEHYRLRFDGKNWDYVSTCA
KDLVARMLQSDPHKRISVFEAMDHFWVNNFVEVNHDEPHSTVGNLDSTQELIRALSNATD
TTFVIPYSESCIGNLKALQAAEAEAALETVLE
Download sequence
Identical sequences A7ASW0
XP_001609589.1.62033 gi|154796841|gb|EDO06021.1| gi|156084212|ref|XP_001609589.1| gi|156084212|ref|XP_001609589.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]