SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000052 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000052
Domain Number 1 Region: 440-657
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.1e-55
Family DBL homology domain (DH-domain) 0.00014
Further Details:      
 
Domain Number 2 Region: 223-355
Classification Level Classification E-value
Superfamily BRCT domain 1.96e-23
Family DNA ligase 0.026
Further Details:      
 
Domain Number 3 Region: 133-251
Classification Level Classification E-value
Superfamily BRCT domain 1.89e-18
Family DNA ligase 0.024
Further Details:      
 
Domain Number 4 Region: 648-793
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000553
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000052   Gene: ENSORLG00000000041   Transcript: ENSORLT00000000052
Sequence length 952
Comment pep:novel chromosome:MEDAKA1:4:48709:83853:-1 gene:ENSORLG00000000041 transcript:ENSORLT00000000052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSSMLSLGAARSLLVDSSVCDSRIAEVTSDHTFLAAACEDEEEMLPKVETRVVLVGEA
GRNQVLVKTLQAIRMMEVPVVKIREGDASAKEKMMIKSIVSMDINTPFLVTDNVQEFAEG
DGAEFETVFVLTDFDTSDYSFLHRRDNRIVGPPVVFHCAAKEEPMLFSCRPLYCTAMLNL
SLCLTGFRNKEEMKNLVNLVHHMGGTIRKDFSTKVTHLVAYSTHGEKYRLAVCMGTPILT
PLWIQKSWERRDDVDFHAGQEEFRSEFKVPPFQDCVLSFLGFSEEEKANMEERTELKGGR
YLEVGDERCTHLVVEENSVRELLTSSKKLYVVKQEWFWGSIQMDARAGESMYLYEKNDSP
AMKKAVSLLSLTTPNSNRKRRRLKDTLAQLSKETEMSPFPPPRKRASAENSLSIGSLLDI
SNTPETCKGLTGESKDLVPNKSSTPVLSKQSARWQVSRELYQTESNYVDILSTILQLFKH
PLEKEGQVGGAILAQEEVKTIFGNIPDIFEVHTQIKNDLEELLSDWSENRSVGNIFLKYS
KELVKAYPPFVNFFEMSKETIVRCEKQKPRFHAFLKINQAKPECGRQTLVELLIRPVQRL
PSVALLLNDIRKHTSDDNPDKITLEKAIESLKEVMTHINEDKRKTEGQKQIFDVVYEVDG
CPANLLSSHRSLVQKVETVALGDQPCDRGEQVTLFLFNDCLEIARKRHKVINTFKSPLGQ
TRPPPPLKHISLMPLSQIRRVLDLQDTEECVNAFALVVRPPTEQENLLFSFQLVGEETVK
SAWLRTLCRHVANTICRADAEDLIQITDPDSLQVSTKDMDSTLSKASRAIKKTSKKVTRA
FSFTKTPKRAIQRAFMANTTPDKKTQRLSCENRVCSSATLAMSRSTSTFSLSDSAKSSAV
VQRSNSLDHPPLRTRVPVCICTPAPSPSSSSPSYPAASGNQESQSPSSTPSL
Download sequence
Identical sequences H2L2V2
ENSORLP00000000052 ENSORLP00000000052 8090.ENSORLP00000000052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]