SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000088 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000088
Domain Number 1 Region: 61-117
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 116-173
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.09e-18
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 3 Region: 343-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-17
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 4 Region: 190-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.57e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 303-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000244
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 6 Region: 228-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000236
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 7 Region: 384-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000344
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 8 Region: 19-70
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000181
Family Classic zinc finger, C2H2 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000088   Gene: ENSORLG00000000076   Transcript: ENSORLT00000000088
Sequence length 440
Comment pep:novel chromosome:MEDAKA1:3:2199733:2201226:-1 gene:ENSORLG00000000076 transcript:ENSORLT00000000088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGLDISHLANPHEHQCMVTQDRSFQCTQCMKIFSQATDLLEHQCVQVEQKPFVCGVCKMG
FSLLTSLAQHHNSHGNDRPYKCSVCHKSFRHLSELTRHERTHTGEKPYKCDTCDKSFSQS
SHLAHHQRTHSSERPYKCAVCEKSFKHRSHLVRHMYAHSGEHLFKCNLCEMHFKESSELL
HHQCQPEGERPFRCGSCGKSFKRPSDLRQHERTHSEERPFQCEECQMSFKQQYALVRHRR
THKNPADRPFKCNLCDKSFLQPSHLLYHQQVHGMESLFKCASCQKSFSQSGELLRHKCGG
EVEKPYKCDVCGKGYKKNSTLQRHQNTHCTEKPLKCSLCDKRFVSSSEFVQHRCDPTREK
PLKCPDCEKRFRYSSELQRHRRVHTGEKPFKCANCDKSFKQREHLAKHQSVHSRETQFKC
VWCGERFVDLAALQEHTVQH
Download sequence
Identical sequences H2L2Y4
8090.ENSORLP00000000088 ENSORLP00000000088 ENSORLP00000000088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]