SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000120 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000120
Domain Number 1 Region: 1054-1106
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000242
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 302-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000792
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 3 Region: 1018-1069
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000336
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 235-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000384
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 5 Region: 680-725
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000941
Family Homeodomain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000000120
Domain Number - Region: 592-626
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0523
Family Classic zinc finger, C2H2 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000120   Gene: ENSORLG00000000098   Transcript: ENSORLT00000000120
Sequence length 1243
Comment pep:novel chromosome:MEDAKA1:2:5534132:5557810:-1 gene:ENSORLG00000000098 transcript:ENSORLT00000000120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGLIASQASRPFVLPSSAPAPPTPPLLLSPPAKLGGVVRRRQAQASPCRKETLNYENVVE
TGSETEEEDKLPVSEEEPLINGAGSPASLTNPEASPHAEGHGLLTKDEEDDEMRDSGVEH
IWQDNDMLSASVDGTDEMKYDFDSLGPEATLQGVGNGTVKSMDCTSELEDFFAKRKLDDG
DSHVVSIAECLRRGDTAIIYPEAPEELSRLGTPEATGPEENDLPPGTPDAFAQLLTCPYC
DRGYKRLTSLKEHIKYRHEKNEENFACPLCNYTFAYRTQLERHMATHKPARDQHQMLNQE
AGNRKFKCAECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCIG
LIAVNGRMRNSMKPGSSPTSASASPTNTAITQLRQKLENGKPLGLADHNNHLNIKTEPLD
FNDYKLMMASHGFGAPGTFLNGVGGSSPLGVHHSSTGQSPLQHLGLAGLDPQLLGYPGSL
GNNLSEVQKVLQIVDNTVCRQKMDCKPEELSKLKAYMKELGNQAEEQKQAMNSPGGPQVG
LPLVNHNGATKSIIDYTLEKVNEAKACLQSLTTDSKRQISNIKREKANHMLDGGMDEKVP
ENMFTPYACQYCKETFPGPIPLHQHERYLCKMNEEIKAVLQPSENMMPNKPPMFMEKNNH
LSSSMLSEKGLTGPLNPYRDHMSVLKAYFAMNMEPNSEELLKISIAVGLPQIFVKEWFEQ
RKMYEYSTTRSPPLEHRNTTDMVVGTNNHSPPKDSLAARSPVSLMKHVDHITSSSIAEHQ
NNCDNPLRHLKNHQFGGSAKAAGEKLDHSRSNTPSPLNLSSASSKNSHSSSYTPNSLTSE
DLQAEPLDLSLPRLMKEPKHALTVKSRPKANSITIDHNSIPSPREHFEEPLNLAYLKKEF
SGSTNDRNIEKSTSPIFGINPFAAKPLYTSLPPQSAFPPTTFMPPMQASIPGLRPYPGMD
QMGFLPHMAYTYAAGAATFAEMQQRRKYQRKPGFQGDLLDGTPDYLSGLDDMTDPDSCLS
RKKIKKTESGMYACDLCDKTFQKSSSLLRHKYEHTGKRPHQCQICKKAFKHKHHLIEHSR
LHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCKREAEEREAAEREAREKGHLEPTELL
MSRAYLQGMTPQGYPELAEREAILRHDGVNGGIREGHKEVDGTYAKIARRDEFEEEEESK
SMDTDPDTLRDEEENGEHSMDDSSLDGKTETKSDHEDAMEDPM
Download sequence
Identical sequences H2L314
ENSORLP00000000120 ENSORLP00000000120 8090.ENSORLP00000000120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]